KEYWORDS: language evolution, mathematical modelling, branching processes . ... 2 Basic assumptions. ... Dying out, giving birth, and preserving of sign's meanings. ... Modelling of language evolution should be based on some assumptions concerning its micro-level, i.e. level of its micro-units' development. ... That is why it has become the starting point in the building of the mathematical model for the development in time and synchronic correlation of the whole system of a sign's features. ...

Еще в разделе: (Показать все результаты (>36) - old.philol.msu.ru/ )

• Konferences

... P ast C S et. e C P aste = {e C : e e} н , e, e1 e2 P aste1 e2 : P aste1 P aste2 , . P ast [2] . ... S etC . ... Loc P ast [2] . ... 13): (мLo c)e = {w W : e , (мLo c = ) (e C w W P aste w = ). 3.2. мLo c . ... Glob (4) [Loc ] : Glob , [Loc ]e (w) = df [F ] (30) (31) {(e e) M orC (§, e) : e w}. e, , , e , , w. e w, (31) e н , P aste w = , (31) () н . ... e e0 {(e e) M orC (§, e) : Lo ce Lo ce0 = }. 8 (33) (32) Loc Lo ce0 , Lo ce0 : [Lo ce0 ]e = Lo ce0 e. , e0 e, (33) e. , (33) , P aste e0 . ...

Еще в разделе: (Показать все результаты (>230) - chronos.msu.ru/ )

• Ильичев Л. В. (Il'ichov L. V.)

ICASS VI Programme Session 06.02: World history of the last century reflected in life stories of autochthonous minorities in the North 23.08.2008 Chair: Kazakevich, Olga; Lomonosov Moscow State University; Russia Co-Chair: Burkova, Svetlana; Institute of Philology, Russian Academy of Sciences, Siberian branch; Russia 1. ... Koshkareva, Natalya; Institute of Philology, Russian Academy of Sciences, Siberian Branch; Russia 3. Changes in Russia in 1920-50s through Forest Nenets Life Stories . ...

Еще в разделе: (Показать все результаты (>6) - lcl.srcc.msu.ru/ )

• ЛАБОРАТОРИЯ АВТОМАТИЗИРОВАННЫХ

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. November 11, 1997 . The Annotated Galactic Center . ... Constellations of nearby stars include Sagittarius , Libra , Scorpius , Scutum , and Ophiuchus . ... Open clusters include M6 , M7 , M18 , M21 , M23 , M24 , M25 . Globular clusters include M9 , M22 , M28 , M54 , M69 , M70 . ... About APOD > . ... NASA Technical Rep.: ...

Еще в разделе: (Показать все результаты (>18) - www.arcetri.astro.it/ )

• APOD: August 31, 1997 - Arp 230: Two Spirals in One?
• APOD: 2000 July 13 - LP 944-20: A Failed Star Flares

... Specialist degree . ... Master degree . ... Master variants . ... About Faculty . ... Mechmath faculty admission resumed its work and is actively preparing for the new reception 2015! ... Read more about Schedule in June . ... The Dean of Mechanics and Mathematics Faculty, the head of the Department of Mathematical and Computer Analysis Methods, professor Vladimir Chubarikov ; . ... Read more about The Open Day . ... 2016 Mechmath admission for internetional students ...

Еще в разделе: (Показать все результаты (>6) - pk.math.msu.ru/ )

• First Education | Mechmath admission for internetional students
• About Mathematics and Mechanics Faculty | Mechmath admission for internetional

... chief researcher G.N.Simkin , prof. I.R.Beme , researcher S.M.Smirenskiy , senior researcher N.D.Poyarkov , researcher V.B.Masterov , senior researcher M.Yu.Soloviev , researcher V.D.Anisimov , leading engineer M.N.Dementiev . ... chief researcher G.N.Simkin , prof. I.R.Beme , leading researcher V.M.Gavrilov , researcher A.B.Popovkina , senior researcher N.D.Poyarkov , researcher V.B.Masterov , senior researcher M.Yu.Soloviev , junior researcher E.N.Rahimberdiev , leading engineer M.N.Dementiev . ...

Еще в разделе: (Показать все результаты (>72) - vertebrata.bio.msu.ru/ )

... айзйлоЦкД дДд игДбеЦззхв йЕцЦдн ї Ц ЫiЛПУ, г.е., 1998 - ( ) , - . ... 100 , Bi in , . ... 4) , (B ) (V V ) , a V d = c [ E Ч b ] / B , b = B / B. ЦкмпаейЗ г.е. айзйлоЦкД бЦега дДд дйлеауЦлдДь игДбеЦззДь гДЕйкДнйкаь 73 C (3)-(5) F = - grad P , P = NT ( = 1,38 Ч Ч 10- 16 / - , grad P = = ( P ( r 1 ) - P ( r 2 ) ) / ( r 1 - r 2 ) r ). , , . ... 2, PB e E -1 P + P W = N T i + T e + --------------- ( 1 + 1 ) = const. (10) 2 m 2 2 ЦкмпаейЗ г.е. айзйлоЦкД бЦега дДд дйлеауЦлдДь игДбеЦззДь гДЕйкДнйкаь 75 () ...

Еще в разделе: (Показать все результаты (>25) - www.kosmofizika.ru/ )

. Photographers: Yuri Artukhin . scientist in a staff of Institute of Ecology and Land use, Kamchatka branch . Alexander Ladyguin . in a staff of Moscow State University Science Park . Alexey Mazlov . scientist in a staff of Pacific Salmon Institute . Vitaliy Nikolaenko . scientist in a staff of Kronotskiy State Biopsphere Reserve . Archive | Publications | Projects | Authors . Contacts | Russian .

Еще в разделе: (Показать все результаты (>56) - www.fadr.msu.ru/ )

• Фотоархив "EcoPhoto" - Публикации
• "EcoPhoto" - Publications
• IV International Conference on Cryopedology

DVM debugger - contents . Part 1 (1 - 4) . ... Writing to read-only variable is detected. ... Using non-initialized element <elem> . ... Using variable <var> before asynchronous reduction competed . ... The dynamic debugger detects access to a shadow element before asynchronous shadow renew competed . ... It is reported when any non-correspondence of trace or loop description file is detected. ... Different values of reduction operation are detected for current event and in reference trace record. ...

Еще в разделе: (Показать все результаты (>82) - sp.cs.msu.ru/ )

• Lib-DVM. Interface description. Part 5 (14-15)
• Fortran DVM - Language for Portable Parallel Programs Development
• C-DVM compiler. User's guide

... Scientific directions . ... The research of the department of General Problems of Control has taken four major directions, each of which has several branches. ... general Lagrange principle, problems of convex analysis and methods of duality in the theory of extremal problems . ... free-boundary problems . ... Optimization, optimal control, numerical methods and questions of applied mathematics: . ... 119992 Moscow, GSP-1, Leninskie Gory, MSU, mechanics and mathematics department, OPU, Room 13-14 . ...

Еще в разделе: (Показать все результаты (>22) - new.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Matematika, Mekhanika

... Conference Venue . ... Kirk Hatfield University of Florida, Department of Civil and Coastal Engineering, Gainesville, USA . ... Irina V. Perminova Co-Chair of Organizing Committee, Department of Chemistry, Lomonosov MSU, coordinator of the CIS IHSS chapter . ... Olga Yakimenko Conference Secretary, Department of Soil Science, Lomonosov MSU . ...

Еще в разделе: (Показать все результаты (>52) - mgumus.chem.msu.ru/ )

... Dubna & our Venue . ... Dubna branch of the Skobeltsyn Institute of Nuclear Physics, Moscow State University . ... Dubna is located 120 km north of Moscow on the Volga river banks. ... The trains from Moscow to Dubna depart from Savelovsky railway ("Savelovskaya" metro station). there are two railway stations in Dubna: station "Bolshaya Volga" and terminal "Dubna". ... There are two railway stations in Dubna: station "Bolshaya Volga" and terminal station "Dubna". ... from station 'Dubna' . ...

Еще в разделе: (Показать все результаты (>6) - www.elch.chem.msu.ru/ )

Left Branch Extraction and Interpretation of Multiple Wh-Questions In this paper I examine a surprising behavior of Serbo-Croatian (SC) multiple wh-questions with left branch extraction (LBE), such as (1), with respect to their interpretation. The analysis leads to several conclusions regarding the nature of LBE as well as the interpretation of multiple questions discussed in Boskovi (2003), Hagstrom (1998), Citko and Grohmann (2001), and Grebenyova (2006), among others. ... The question is why. ...

Еще в разделе: (Показать все результаты (>176) - www.philol.msu.ru/ )

• LangueDOC :: Tools :: Text conversions
• Speech rhythm in diachrony and synchrony
• LangueDOC :: Khinalug

... SDPfox - the software package for the prediction of functional specificity groups and amino acid residues that determine the specificity using MPA. ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ...

Еще в разделе: (Показать все результаты (>16) - bioinf.fbb.msu.ru/ )

• RNA Alignment
• SDPpred
• Alignment example

IA-64 Architecture Innovations February 1999 Joint Whitepaper between Intel & HP Background New workloads such as internet communications, e-commerce, Decision Support Systems, In Memory Databases, Digital Content Creation, and Compute intensive CAD etc. place heavy demands on high performance servers and workstations. ... Furthermore, with four times the number of registers provided with traditional RISC architectures, IA-64 has the data working area needed for high performance loop execution. ...

Еще в разделе: (Показать все результаты (>236) - www.parallel.ru/ )

• http://www.parallel.ru/sites/default/files/ftp/cluster/intel-8.0/asm_ug.pdf
• Typedefs | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Choice | PARALLEL.RU - Информационно-аналитический центр по параллельным

... Twenty five years ago the first Russian papers dedicated to Surface Nonlinear Optics were published. This 25th anniversary allows us to look back on the early 1980s, the time of appearance of Surface Nonlinear Optics as a branch of Optics. Pioneering works by Prof. Y.R. Shen in the early 1980s, which were based on the 1960s fundamental ideas of Prof. N. Bloembergen, stimulated an explosion of such studies at Moscow State University and around the world. ... March 2008 ...

Еще в разделе: (Показать все результаты (>10) - shg.phys.msu.ru/ )

• Publications Keywords Search

Near-Infrared spectroscopic imaging of cardiovascular disease Kupriyanov V.V. Institute for Biodiagnostics, 435 Ellice Avenue, Winnipeg, R3B 1Y6, Canada, 1-204-9846620, Valery.Kupriyanov@nrc-cnrc.gc.ca Applications of near-infrared spectroscopic (NIRS) imaging to detection, localization and grading of acute cardiac ischemia and chronic infarction in pig models in vivo are described. ... NIRS imaging is well suited for intraoperative applications during coronary artery bypass surgery in humans. ...

Еще в разделе: (Показать все результаты (>10) - www.msm.biophys.msu.ru/ )

• Transport and Maps

... A history of creation and development of scientific direction "Immobilized Enzymes" in Russia and the international conference "Biocatalysis. ... Also reflects the stages of creation and development of national and then international scientific conference "Biocatalysis. ... Moscow University Chemistry Bulletin . 2014, Vol. ... Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ...

Еще в разделе: (Показать все результаты (>155) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 55, No. 6, P. 315 (2014)
• Nikolai M. Emanuel
• Gleb B. Sergeev, Kenneth J. Klabunde. Nanochemistry. 2nd edition