... These spectral characteristics compare with introduction (ВВЕДЕНИЕ) At last time many workers have studied thermal Rayleigh-Benard convection using numerical At last time many workers have studied thermal Rayleigh- Benard convection using numerical time many At last time many workers have studied thermal Rayleigh-Benard convection using numerical used spectral methods with periodic boundary conditions. ... In numerical simulations were derived secondary stationary, [pic] where ? ...

Еще в разделе: (Показать все результаты (>8) - hit-conf.imec.msu.ru/ )

Hadronic resonance production with the ALICE experiment in pp and Pb-Pb collisions at LHC energies Sergey Kiselev (ITEP Moscow ) for the ALICE collaboration ITEP · · · · · Motivation Analysis details pp@7 TeV: K*(892)0, (1020), (1385) Pb-Pb@2.76 ATeV: K*(892)0, (1020) Summary XVI Lomonosov EPP , Moscow S.Kiselev 1 22-28 Aug ... EPJ C72(2012)2183 K*/K - /K* both K*/K- and /K* independent of s 22-28 Aug 2013 XVI Lomonosov EPP, Moscow S.Kiselev 8 pp: particle ratios / ALICE Coll. ...

Еще в разделе: (Показать все результаты (>69) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/epp10/Polyakov.pdf
• http://nuclphys.sinp.msu.ru/mirrors/1999_5.pdf
• http://nuclphys.sinp.msu.ru/school/s08/s08_43.pdf

... P ast C S et. e C P aste = {e C : e e} н , e, e1 e2 P aste1 e2 : P aste1 P aste2 , . P ast [2] . ... S etC . ... Loc P ast [2] . ... 13): (мLo c)e = {w W : e , (мLo c = ) (e C w W P aste w = ). 3.2. мLo c . ... Glob (4) [Loc ] : Glob , [Loc ]e (w) = df [F ] (30) (31) {(e e) M orC (§, e) : e w}. e, , , e , , w. e w, (31) e н , P aste w = , (31) () н . ... e e0 {(e e) M orC (§, e) : Lo ce Lo ce0 = }. 8 (33) (32) Loc Lo ce0 , Lo ce0 : [Lo ce0 ]e = Lo ce0 e. , e0 e, (33) e. , (33) , P aste e0 . ...

Еще в разделе: (Показать все результаты (>219) - chronos.msu.ru/ )

• Ильичев Л. В. (Il'ichov L. V.)

... Specialist degree . ... Master degree . ... Master variants . ... About Faculty . ... Mechmath faculty admission resumed its work and is actively preparing for the new reception 2015! ... Read more about Schedule in June . ... The Dean of Mechanics and Mathematics Faculty, the head of the Department of Mathematical and Computer Analysis Methods, professor Vladimir Chubarikov ; . ... Read more about The Open Day . ... 2016 Mechmath admission for internetional students ...

Еще в разделе: (Показать все результаты (>6) - pk.math.msu.ru/ )

• First Education | Mechmath admission for internetional students
• About Mathematics and Mechanics Faculty | Mechmath admission for internetional

. N E W P R O D U C T . F . e . m . t . o . S . c . a . n . 0 . 0 . 1 . Software . Microscope . FemtoScan . Microscope features: . Multiprocessor operation . Digital feedback . Full computer control . Multitask regime . Simultaneous acquisition up to 8 images in different modes . Software: . Windows 95, NT compatible . Multitasking . Internet access . Friendly interface . Variety of file formats (Nanoscope, FemtoScan etc.) . Wide set of mathematical functions . © Advanced Technologies Center, 1998

Еще в разделе: (Показать все результаты (>16) - www.spm.genebee.msu.ru/ )

• FemtoScan Online program

This is a public domain shell written by the Free Software Foundation under their GNU initiative. ... This shell is widely used within the academic commnity. bash provides all the interactive features of the C shell (csh) and the Korn shell (ksh). Its programming language is compatible with the Bourne shell (sh). If you use the Bourne shell (sh) for shell programming consider using bash as your complete shell environment. Summary of features . ...

Еще в разделе: (Показать все результаты (>93) - comet.sai.msu.ru/ )

• Understanding HTML and MIME
• The case statement
• Command arguments

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

An annotated checklist of the insectivores (Mammalia, Lipotyphla) of Vietnam . Abramov A.V., Dang Ngoc Can, Bui Tuan Hai Nguyen Truong Son . P. 57-70 . An annotated checklist of 32 extant species from 12 genera of the insectivores (Mammalia, Lipotyphla) of Vietnam is provided. ...

Еще в разделе: (Показать все результаты (>790) - zmmu.msu.ru/ )

• RBR homepage
• Types Database
• XIV International Ornithological Conference of North Eurasia: Organizers

RIDGE AND TREE FEATURE DETECTION ON IMAGES A. Levashov 2, D. Yurin3 2, 3 1 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia 2 alexeylevashov89@gmail.com , 3yurin@cs.msu.ru In this article a new ridge detector with improved non-maxima suppression procedure in scale-space is proposed. ... The algorithm is tested on synthetic, landscape and medical images. ...

Еще в разделе: (Показать все результаты (>4) - imaging.cs.msu.ru/ )

Near-Infrared spectroscopic imaging of cardiovascular disease Kupriyanov V.V. Institute for Biodiagnostics, 435 Ellice Avenue, Winnipeg, R3B 1Y6, Canada, 1-204-9846620, Valery.Kupriyanov@nrc-cnrc.gc.ca Applications of near-infrared spectroscopic (NIRS) imaging to detection, localization and grading of acute cardiac ischemia and chronic infarction in pig models in vivo are described. ... NIRS imaging is well suited for intraoperative applications during coronary artery bypass surgery in humans. ...

Еще в разделе: (Показать все результаты (>8) - www.msm.biophys.msu.ru/ )

... Each day a different image or photograph of our fascinating universe is featured, along with a brief explanation written by a professional astronomer. November 11, 1997 . The Annotated Galactic Center . ... Constellations of nearby stars include Sagittarius , Libra , Scorpius , Scutum , and Ophiuchus . ... Open clusters include M6 , M7 , M18 , M21 , M23 , M24 , M25 . Globular clusters include M9 , M22 , M28 , M54 , M69 , M70 . ... About APOD > . ... NASA Technical Rep.: ...

Еще в разделе: (Показать все результаты (>4) - www.arcetri.astro.it/ )

... Dubna & our Venue . ... Dubna branch of the Skobeltsyn Institute of Nuclear Physics, Moscow State University . ... Dubna is located 120 km north of Moscow on the Volga river banks. ... The trains from Moscow to Dubna depart from Savelovsky railway ("Savelovskaya" metro station). there are two railway stations in Dubna: station "Bolshaya Volga" and terminal "Dubna". ... There are two railway stations in Dubna: station "Bolshaya Volga" and terminal station "Dubna". ... from station 'Dubna' . ...

Еще в разделе: (Показать все результаты (>5) - www.elch.chem.msu.ru/ )

DVM debugger - contents . Part 1 (1 - 4) . ... Writing to read-only variable is detected. ... Using non-initialized element <elem> . ... Using variable <var> before asynchronous reduction competed . ... The dynamic debugger detects access to a shadow element before asynchronous shadow renew competed . ... It is reported when any non-correspondence of trace or loop description file is detected. ... Different values of reduction operation are detected for current event and in reference trace record. ...

Еще в разделе: (Показать все результаты (>74) - sp.cs.msu.ru/ )

• Fortran DVM - Language for Portable Parallel Programs Development
• Fortran DVM compiler. User's guide
• C-DVM compiler. User's guide

... Conference Venue . ... Kirk Hatfield University of Florida, Department of Civil and Coastal Engineering, Gainesville, USA . ... Irina V. Perminova Co-Chair of Organizing Committee, Department of Chemistry, Lomonosov MSU, coordinator of the CIS IHSS chapter . ... Olga Yakimenko Conference Secretary, Department of Soil Science, Lomonosov MSU . ...

Еще в разделе: (Показать все результаты (>45) - mgumus.chem.msu.ru/ )

. Photographers: Yuri Artukhin . scientist in a staff of Institute of Ecology and Land use, Kamchatka branch . Alexander Ladyguin . in a staff of Moscow State University Science Park . Alexey Mazlov . scientist in a staff of Pacific Salmon Institute . Vitaliy Nikolaenko . scientist in a staff of Kronotskiy State Biopsphere Reserve . Archive | Publications | Projects | Authors . Contacts | Russian .

Еще в разделе: (Показать все результаты (>70) - www.fadr.msu.ru/ )

• Фотоархив "EcoPhoto" - Публикации
• "EcoPhoto" - Publications
• IV International Conference on Cryopedology

... айзйлоЦкД дДд игДбеЦззхв йЕцЦдн ї Ц ЫiЛПУ, г.е., 1998 - ( ) , - . ... 100 , Bi in , . ... 4) , (B ) (V V ) , a V d = c [ E Ч b ] / B , b = B / B. ЦкмпаейЗ г.е. айзйлоЦкД бЦега дДд дйлеауЦлдДь игДбеЦззДь гДЕйкДнйкаь 73 C (3)-(5) F = - grad P , P = NT ( = 1,38 Ч Ч 10- 16 / - , grad P = = ( P ( r 1 ) - P ( r 2 ) ) / ( r 1 - r 2 ) r ). , , . ... 2, PB e E -1 P + P W = N T i + T e + --------------- ( 1 + 1 ) = const. (10) 2 m 2 2 ЦкмпаейЗ г.е. айзйлоЦкД бЦега дДд дйлеауЦлдДь игДбеЦззДь гДЕйкДнйкаь 75 () ...

Еще в разделе: (Показать все результаты (>26) - www.kosmofizika.ru/ )

... Scientific directions . ... The research of the department of General Problems of Control has taken four major directions, each of which has several branches. ... general Lagrange principle, problems of convex analysis and methods of duality in the theory of extremal problems . ... free-boundary problems . ... Optimization, optimal control, numerical methods and questions of applied mathematics: . ... 119992 Moscow, GSP-1, Leninskie Gory, MSU, mechanics and mathematics department, OPU, Room 13-14 . ...

Еще в разделе: (Показать все результаты (>15) - new.math.msu.su/ )

... Полная версия этой страницы: Продам Hitachi 32x СD-ROM drive for CD-R / RW discs . Студенческий форум Физфака МГУ > Общий > Все обо всем > Объявления . ... CD-ROM drive for multimedia PC applications . 32x max speed . ... CD-R / RW disc compatible . ... я думаю на форуме не найдется клинических идиотов) . ... на маркете гзшного форума быстрее продашь, имхо . ... с местоположением темы немного не угадал, есть Студенческий форум Физфака МГУ > Общий > Все обо всем > Объявления . ...

Еще в разделе: (Показать все результаты (>81) - wasp.phys.msu.ru/ )