... Robert Hermann Brookline, MA (Received November 22, 1999) der to illustrate the obvious progress, one can mention a variety of examples. ... In or- FYI Item "BMS Report on Institutes" As a member of the panel commissioned by the Board on Mathematical Sciences of the National Research Council, I write to correct several inaccuracies in the "For your information" note by Allyn Jackson entitled "BMS Report on Institutes" in the December 1999 issue of the Notices. ...

Еще в разделе: (Показать все результаты (>71) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/prokhorov/phd/phd.htm
• Research interests

... Mosekilde E. Department of Physics, Technical University of Denmark, Kgs. ... The purpose of this talk is to demonstrate the essential role that nonlinear dynamic phenomena play in normal physiological regulation and in the development of various diseases. ... Regulation of pressures and flows in the individual nephron involves the interaction between the tubuloglomerular feedback mechanism (TGF) and the oscillatory response of the activated afferent arteriole. ... 2007 Biophysics dep., ...

Еще в разделе: (Показать все результаты (>62) - www.msm.biophys.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

On synthesizing impulsive controls and the theory of fast controls Aleksandr B. Kurzhanski Moscow State University, Moscow, Russia e-mail: kurzhans@mail.ru, kurzhan@cs.msu.su The report deals with the problem of constructing closed-loop (feedback) controls for systems that allow impulsive control inputs described through generalized "delta" functions and their derivatives. Such problems, having had a serious applied motivation, were mostly considered within the framework of open-loop control. ...

Еще в разделе: (Показать все результаты (>60) - pont2008.cmc.msu.ru/ )

• http://pont2008.cs.msu.ru/files/en/abstracts/Brockett.pdf
• http://pont2008.cs.msu.ru/files/en/abstracts/Gamkrelidze.pdf
• http://pont2008.cs.msu.ru/files/en/abstracts/Agrachev.pdf

... Reports on progress and error are always recorded in the log file of the program. ... UT date of the measurement finish in YYYY-MM-DD format UT time of the measurement finish in hh:mm:ss format Average flux in A aperture Average flux in B aperture Average flux in C aperture Average flux in D aperture Normalized variance of flux in A aperture Normalized variance of flux in B aperture Normalized variance of flux in C aperture Normalized variance of flux in D ...

Еще в разделе: (Показать все результаты (>23) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/res2007eng.pdf
• . The . MASS . Group .

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>18) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• Nhunt: program for nucleic acid sequence similarity search
• Nhunt

... CELL BIOPHYSICS Application of a Photosystem II Model for Analysis of Fluorescence Induction Curves in the 100 ns to 10 s Time Domain after Excitation with a Saturating Light Pulse N. E. Belyaevaa, V. Z. Pashchenkoa, G. Rengerb, G. Yu. ... In the case of weak measuring light, the steady-state level of fluorescence induction curve (Fig. ... The model of PSII predicted that, upon long (10 s) exposure to weak measuring light, the states with open RCs are being populated (Fig. 4, curves 3, 5 QA). ......

Еще в разделе: (Показать все результаты (>37) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3344.pdf
• http://library.biophys.msu.ru/PDF/3329.pdf
• http://library.biophys.msu.ru/PDF/3335.pdf

RIDGE AND TREE FEATURE DETECTION ON IMAGES A. Levashov 2, D. Yurin3 2, 3 1 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia 2 alexeylevashov89@gmail.com , 3yurin@cs.msu.ru In this article a new ridge detector with improved non-maxima suppression procedure in scale-space is proposed. ... The algorithm is tested on synthetic, landscape and medical images. ...

Еще в разделе: (Показать все результаты (>11) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2013.PRIA.Mamaev_Lukin_Yurin.HermiteNLM.en.pdf

... Other Worlds and HD 38529 . ... 10.08.2000 . ... While extrasolar planet discoveries are sure to continue, none - so far - points clearly to another planetary system like our own . Take, for example, the newly discovered parent star HD38529 . ... In this dramatic artist's vision, HD38529 and its newfound world are viewed from the moon of another massive ringed planet orbiting farther out. ... 1999 2000 . ... NASA Web Site Statements, Warnings, and Disclaimers . ... Saturn-Sized Worlds Discovered . ...

Еще в разделе: (Показать все результаты (>6128) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• Астронет > Other Worlds and HD 38529
• Footprints on Another World

Michael H. Shulman, 2012 (shulman@dol.ru) Is it possible to travel in Time? ... The first one is based on the common modern representations; I will call it "the W heeler-Feynman's argument". ... Additionally, we will consider a Time travelling using "wormholes" in spacetime. ... Geometrical argument It useful to note that in fact any travelling (and even rest state) turns out to be the travel in Time, since the stream of Time is the more general process in the Universe . ... Outside of our Universe? ...

Еще в разделе: (Показать все результаты (>401) - chronos.msu.ru/ )

• http://temporology.bio.msu.ru/EREPORTS/shulman_sr.pdf
• http://temporology.bio.msu.ru/EREPORTS/correlations.12yr.pdf
• http://temporology.bio.msu.ru/EREPORTS/koehler_understanding.pdf

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>69) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... Universitetskaya 1, Izhevsk, 426034 Russia Abstract This pap er investigates the p ossibility of the motion control of a ball with a p endulum mechanism with non-holonomic constraints using gaits -- the simplest motions such as acceleration and deceleration during the motion in a straight line, rotation through a given angle and their combination. ... This paper investigates the control led motion of a ball with a pendulum. ... The angular velo city of the pendulum has the form 2 = . ...

Еще в разделе: (Показать все результаты (>132) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/a49/RCD716.pdf
• http://ics.org.ru/upload/iblock/d2d/196-the-dynamics-and-control-of-a-spherical-robot-with-an-internal-omniwheel-platform_ru.pdf
• http://ics.org.ru/upload/iblock/ecf/PHDK32.pdf

... In vitro, the protein S7 of Thermus thermophilus is able to form complexes with both the minimal 16S rRNA fragment and the intercistronic region of the str operon mRNA from E.coli (Kd = 1.4x10-7 M and 1.1x10-7 M respectively). ... The filter binding assay. ... The most striking result of our study is that thermophilic protein S7 binds strongly to the E.coli S12-S7 intercistronic region of str mRNA in vitro, inspite of the lack of the functionally analogous thermophilic extended region. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/article_vas_bioelectro.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2003.pdf
• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf

... Only by numerical simulation. ... moment T (K) Dipole moment (D) Experiment Other example: Diffusion constant 200 250 298 350 400 2.40 2.37 2.48 2.59 2.80 2.25 The Distribution functions: radial distribution function 1 g (r) = N t =1 j i N TS N pair ( r - rij ) The Distribution functions: radial distribution function CC def 2 Work mode ­ computer related 1) · Perform simulation , create trajectory file · Calculate properties timestep by timestep 2) · Perform ...

Еще в разделе: (Показать все результаты (>21) - www.elch.chem.msu.ru/ )

... Cuts with Negative Poisson'S Ratio in Crystals . S.P.Tokmakova (N.N.Andreev Acoustics Institute, Moscow, Russia) . ... For example in crystals it is possible for Poisson's ratio to be negative in one direction and highly positive in another direction. ... The stereographic projections of Poisson's ratio and Gruneisen parameters were computed for each crystal. ... By analysis of the above results the crystals with negative values of Poisson's ratio were revealed. ...

Еще в разделе: (Показать все результаты (>195) - acs366.phys.msu.su/ )

• Abstract (Invited)

... Supercomputing Technologies in Science, Education and Industry Almanac Series . ... Octotron: Active Control for Reliable Functioning of Supercomputers . ... Detection of all damage/failure sources which may occur within supercomputer or data center; . ... Key feature of the Octotron system is representing the supercomputer functioning model in the form of expanded multi-graph. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ... Excursions to Supercomputing Center . ...

Еще в разделе: (Показать все результаты (>69) - hpc.msu.ru/ )

• APPLICATIONS: Theoretical Physics | Moscow University Supercomputing Center
• Welcome to HPC.MSU.RU! | Moscow University Supercomputing Center
• APPLICATIONS: Condensed Matter Physics | Moscow University Supercomputing...

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>5639) - monkey.belozersky.msu.ru/ )

• 1FJL biounits
• Example of supporting positions
• SCOP famyli:

... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: example, IWC such I is States. growth the . ... a href=http://isabelsneakers.zohosites.com/><b>isabel marant</b></a> How lovely it would be if you got a handbag for each day of the week without needing to repeat them. ... http://www.isabelmarantmybest.com . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>4519) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: center China. the example, the
• Russian Journal of Biological Invasions: 2008, issue ? 1
• Экологический Форум - Фундаментальная Экология: Gucci the The example, people

... XIV International Ornithological Conference of North Eurasia . ... ABSTRACTS GUIDELINES . ... Program Committee makes a decision on including the contributed abstracts into the program of the conference and edits a book of abstracts. In case of refusal of the contributed abstracts, Program Committee informs the chief author on the fact individually. ... Abstracts with the proposed status of the presentation (sectional presentation or poster) should be submitted up to 20 December 2014 . ...

Еще в разделе: (Показать все результаты (>1362) - zmmu.msu.ru/ )

• Uropatagium venation pattern in bats as diagnostic character (by the example of
• Russian Journal of Theriology
• Unusual tooth pathology in mammoth (Mammuthus primigenius) from Yakutia

.. , . .. (e-mail: ardyana@yandex.ru) , , corruption, corrupt relations, social control of corrupt relations : , . . The article considers the successfully implemented measures of social control of corrupt relations on the example of three countries: USA, Germany and Singapore. Given the current theoretical and methodological approaches to the control of corruption model of social control are derived in these countries.

Еще в разделе: (Показать все результаты (>46) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2012/3/07.pdf
• http://www.socio.msu.ru/vestnik/archive/2013/4/10.pdf