... use of several physical disks to run each PC GAMESS/Firefly process so that each copy uses only its own HDD. ... The LAM/MPI version 7.1.X. Note that the PC GAMESS/Firefly is not compatible with older LAM/MPI versions e.g., 6.5.9. ... Please consult with the LAM/MPI documentation and manual pages before start experimenting with parallel PC GAMESS/Firefly runs. The LAM/MPI-linked PC GAMESS/Firefly binaries should present on all the computers you plan to run the PC GAMESS/Firefly in parallel . ...

Еще в разделе: (Показать все результаты (>75) - classic.chem.msu.su/ )

• PC GAMESS/Firefly DOCUMENTATION - running in parallel under Windows using
• PC GAMESS/Firefly DOCUMENTATION - running in parallel under Windows using WMPI
• PC GAMESS/Firefly DOCUMENTATION - running in parallel Linux/MPICH binaries

... Fast Facts about the Faculty of Journalism . ... Academic Departments . ... Partners . ... All partners . ... 27.11.2012 On November 28 (Wednesday) at 2.05 pm the Faculty of Journalism will organize a meeting with the Vice-President of the Comoro Islands and graduate of the Faculty of Journalism Fouad Mohadji (room 233). ... 1999-2014 Faculty of Journalism, Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>55) - www.journ.msu.ru/ )

• November 29, 2012 (Thursday) ? lecture of the Norwegian philosopher, journalist
• News :: Department of Journalism, M. V. Lomonosov Moscow State University <span
• The 5th International Media Readings in Moscow "Mass Media and Communications ?

... Seminar archive . ... Type Ia Supernovae (SNe Ia) have an important role to measure a distance to an anonymous galaxy because they have a good correlation of the decline rates of the light curves with the absolute luminosity. ... First, super-Chandrasekhar SNe which have extremely high luminosity, slow decline rate of the light curves, slow expansion velocity and strong carbon features. ... As another example of diversity of SNe Ia, I would like also to introduce Type Iax SNe. ... All seminars: . ...

Еще в разделе: (Показать все результаты (>23) - master.sai.msu.ru/ )

... On the 11 th of November there was a birthday of the greatest Russian writer Feodor Dostoevsky. (more.. 19.11.2003 . ... There are people! ... Dolce vita in Russia . ... The new course for foreign students and native Russians is to be started. ... The Russian language centre gives you an opportunity to become a teacher of Russian. (more.. ... Russia is getting closer to the European Community. ... Students, wake up Siberia! ... Russian proverbs and sayings about Russian language: . ...

Еще в разделе: (Показать все результаты (>11) - www.rlcentre.com/ )

Histone-like proteins from archaea beta-Glucosyltransferase (DNA-modifying) C-terminal domain of RNA polymerase alpha subunit CAP C-terminal domain -like DNA repair glycosylase, 2 C-terminal domains DNA repair protein MutS, domain I DNA-binding protein LAG-1 (CSL) DNA-binding protein LAG-1 (CSL) Endonuclease III Group I mobile intron endonuclease Intein ( protein splicing domain ) Intein ... Multi-domain proteins (alpha and beta) . ... Replication terminator protein (Tus) . ...

Еще в разделе: (Показать все результаты (>212) - monkey.belozersky.msu.ru/ )

• SDP home page
• Example of supporting positions
• SCOP famyli:

Vestnik zoologii, 45(2): 187--190, 2011 УДК 565.76(477) NEW SPECIES OF STILBUS (COLEOPTERA, CLAVICORNIA, PHALACRIDAE) FROM THE LATE EOCENE ROVNO AMBER G. Yu. ... Perkovsky E. E. - The first Eocene species of Stilbus Seidlitz, 1872, S. bedovoyi Lyubarsky et Perkovsky, sp. n., is described from Late Eocene Rovno amber. ... Key words: Phalacridae, Stilbus, Late Eocene, Rovno amber. ... Rovno amber is a southern coeval analogue of the famous Baltic amber (Perkovsky et al., ...

Еще в разделе: (Показать все результаты (>619) - zmmu.msu.ru/ )

• XIV International Ornithological Conference of North Eurasia: Abstracts
• Uropatagium venation pattern in bats as diagnostic character (by the example of

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: example, level Chinese luxury cosmetics b . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>3258) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: that?s received enhanced
• Экологический Форум - Фундаментальная Экология: which is received improved
• Биологические коллекции РФ: Дрожжи (Yeasts) [W - X]

Predictor of DVM-program performance . User's guide . ... With the predictor user can get the predicted time characteristics of execution of his program on MPP or workstation cluster in more or less details. The predictor is the system for processing the trace information gathered by DVM-program Run-Time system (Lib-DVM library) during the program execution on a workstation and consists of two major components: trace interpreter ( PRESAGE) and time estimator (RATER). ... Program execution. ...

Еще в разделе: (Показать все результаты (>103) - sp.cs.msu.ru/ )

• Blue Book Chapter 27
• Design Principles Behind Smalltalk
• Smalltalk-76 Programming System

... III International Conference on Heterocyclic Chemistry, . in Honor of the late Professor A.N. Kost's 95th Anniversary . ... Meeting at the airport/railway station with the sign with the Name of the Conference . ... All the refunds are processed after the Conference with a minus of 10% service fee . If you have any questions, please contact the Technical Secretariat of the Conference: . ...

Еще в разделе: (Показать все результаты (>421) - chem.msu.ru/ )

• Приложение В: Некоторые вопросы и ответы
• Client-side Clickable Image Example
• Moscow University Chemistry Bulletin Vol. 47, No. 3, P. 168 (2006)

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

.

Еще в разделе: (Показать все результаты (>11) - www.chemport.ru/ )

• Real estate market monitoring november 2010 ипотечные ценные бумаги ставки

... Бережной А.А., Клумов Б.А., Фортов В.Е., Шевченко В.В. Письма в ЖЭТФ, Т. 63, N6, С. 387-391, 1996 . ... A. A. Berezhnoy1,2, N. Hasebe1, M. Kobayashi1, G. Michael3 and N. Yamashita1 1Advanced Research Institute for Science and Engineering, Waseda University, Tokyo, Japan 2Sternberg Astronomical Institute, Moscow, Russia 3German Aerospace Center, Institute for planetary research, Berlin, Germany . Brown University - Vernadsky Institute Microsymposium 40, 2004, Moscow, Russia . ...

Еще в разделе: (Показать все результаты (>71) - selena.sai.msu.ru/ )

• Aleksei A. Berezhnoi
• Vladimir V. Busarev
• Geophysical Research Abstracts

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>56) - geophys.geol.msu.ru/ )

• TES. Field example.
• Anis. Page2
• TES tecnology. MSU.

Russian . Next: DSP bard program downloading Up: Additional commands Previous: Additional commands Contents Index . To move the sample on the Z-axis fast (it may need in the end of the work, for example) use SPM/ Move sample menu command. This command allow to move the sample up (to the probe) or down (from the probe) at specified value. Russian . Next: DSP bard program downloading Up: Additional commands Previous: Additional commands Contents Index Filonov 2005-02-04

Еще в разделе: (Показать все результаты (>138) - www.spm.genebee.msu.ru/ )

• Exchanging with messages
• Client
• COM-port calibration

... ОБЩИЕ СВЕДЕНИЯ О СЕТИ ИНТЕРНЕТ . ... Краткая история развития сети . История Интернет уходит своими корнями в ранний период развития компьютеров и компьютерных сетей. ... Осуществление таких жестких требований на практике стало возможным только путем использования уже существовавших компьютерных сетей. ... Но в сети Интернет возможно осуществить и более сложный режим пересылки информации с удаленного компьютера, получивший название протокола FTP (File Transfer Protocol). ...

Еще в разделе: (Показать все результаты (>10) - heritage.sai.msu.ru/ )

... Полная версия этой страницы: Опрос для мужской части . Студенческий форум Физфака МГУ > Общий > Все обо всем > Мальчики-девочки . ... God is a girl, wherever you are, . Do you believe it, can you receive it, . God is a girl, whatever you say, . ... God is a girl, however you live, . ... God is a girl, she's only a girl, . ... 2ELANOR - ну да, ибо форум студенческий, а не ценителей пеггинга и не анонимная имиджборда с разделом "Извращения" (основные источники статистики для моего проекта). ...

Еще в разделе: (Показать все результаты (>621) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Каррент мьюзик
• Студенческий форум Физфака МГУ > Работа в Samsung Electronics для математиков и

. Print . Details . Written by Ольга Жулябина . Published: 30 November -0001 . Russia Today channel visit Moscow State University on July 2 2014. Russia Today channel visit M.V. Lomonosov Moscow State University on July 2 2014. This video is about history and last achievements of University (arabic language). Particular attention has been given to Faculty of Physics and toљ Engineering Physics Laboratory (from 14:30). Link to the video on YouTube . Download video (63,2 Mb, 240p) . љ . љ

Еще в разделе: (Показать все результаты (>40) - engineering.phys.msu.ru/ )

• Meeting with the first course
• Microcontroller Programming

In memory of Sasha Kuznetsov . Only two days ago I came back from a visit abroad to the sorrowful news that our long-time good colleague and friend, a sparkling and noble personality, Alexander Mikhailovitch Kuznetsov, to me and many others, Sasha, had passed away. ... This applied both to his own realm of molecular charge transfer phenomena but also in his interests in broader areas of condensed matter chemical physics. ... Sasha enjoyed high and increasing international respect. ... Back ...

Еще в разделе: (Показать все результаты (>79) - electr003.chem.msu.ru/ )

• Theory as a Lighthouse in the Electrochemical Ocean

... Previously, fileio received the alignment torn-apart into sequence representations as strings with gaps, sequence names and descriptions. ... line source . ... 6 def __init__ ( self , * args , ** kw ): . ... init__ ( self , * args , ** kw ) . ... 9 self . ... 12 def attach ( self , widget ): . ... 15 widget [ command ] = lambda * args , ** kw : self . ... 17 def _command ( self , * args , ** kw ): . ... 24 def _set ( self , sender , * args , ** kw ): . ... 47 def insert ( self , * args , ** kw ): . ...

Еще в разделе: (Показать все результаты (>12969) - kodomo.fbb.msu.ru/ )

• Help: templating
• allpy: ef6692b5ffbc sandbox/ttk.py
• allpy: ef6692b5ffbc

... However, the development of this technique depends on the availability of high performance transducers adapted to power generation constraints allowing to focus and or steer the ultrasonic energy within the volume to be treated. ... In the case of generating CW or long burst wave, problems to be solved are mainly thermal ones while generating very high pulsed pressure wave demands to solve electrical breakdown and mechanical problems. ...

Еще в разделе: (Показать все результаты (>105) - acs366.phys.msu.su/ )

• Abstract