... education . ... Composite materials . Materials for solar and fuel cells . ... Registration deadline is 30 April 2012. ... New deadline is 15 May 2012 . ... Registration fee should be paid before 10 June 2012. ... For information please contact Mrs. Olga Bogomolova: obogomol@gmail.com and Dr. Alexander Chertovich: chertov@polly.phys.msu.ru . ...

Еще в разделе: (Показать все результаты (>44) - nano.msu.ru/ )

• Statutes of the MSU Nanotechnology Education and Research Center | MSU

Head of sector, acting head of the Computational Geophysics Division of the M.V. Keldysh Institute for Applied Mathematics, RAS. ... Finished the Electrodynamics and Quantum Theory Department of Faculty of Physics, MSU in 1962. ... Ill-posed problems, stochastic processes, theory of approximation. Mechanics and physics of multi-phase media, phenomena in porous media, difference schemes for some classes of mathematical physics problems (filtration, elasticity theory). ...

Еще в разделе: (Показать все результаты (>10) - compmech.math.msu.su/ )

... Consider the problem of exchanging one dollar into cents, which could be formulated in the following way: How many are the different solutions of the Diophantine equation 100 = x1 + 2 x2 + 5 x3 + 10 x4 + 20 x5 + 50 x6 , where x1, ..., x6 are unknowns, taking non negative integer values? ... A corresponding programming language which is appropriate of using by secondary students should answer to several criteria. ... One could apply the programming language PHP to solve the above mentioned problem. ...

Еще в разделе: (Показать все результаты (>776) - chem.msu.ru/ )

• http://www.chem.msu.ru/rus/books/2013/inorgworkshop/071.pdf
• PC Crystal Chemistry Analysis of Organic Crystal Structures
• Laboratory of (pre)concentration

МГУ имени М.В.Ломоносова Русская версия . ... Art Criticism and History . ... Economics . ... Associate Professor, PhD in Economics M. V. Artamonova . Associate Professor, PhD in History E. Y. Arkhipova . Associate Professor, PhD in Economics P. S. Kartaev . Associate Professor, PhD in Economics P. A. Kiriushin . Associate Professor, PhD in Economics E. A. Kozeltseva . Associate Professor, PhD in Economics A. A. Kramar . Associate Professor, PhD in Economics S. G. Makarova . ...

Еще в разделе: (Показать все результаты (>90) - conf.msu.ru/ )

... Sergei L. Shishkin . Сергей Львович Шишкин . ... BCI-related papers in peer-reviewed journals . ... Shishkin S.L., Fedorova A.A., Nuzhdin Y.O., Ganin I.P., Ossadtchi A.E., Velichkovsky B.B., Kaplan A.Y., Velichkovsky B.M. Toward high-speed eye-brain-computer interfaces: combining the "single-stimulus" paradigm and saccades. ... PDF ] . ... Shishkin S.L., Ganin I.P., Basyul I.A., Zhigalov A.Y., Kaplan A.Y. N1 wave in the P300 BCI is not sensitive to the physical characteristics of stimuli. ...

Еще в разделе: (Показать все результаты (>75) - brain.bio.msu.ru/ )

• BCI ALBUM | INTERESTING PEOPLE
• Laboratory for Neurophysiology and Neuro-Computer Interfaces (NNCI) (former
• Alexander Zhigalov

Quantum Chemistry in Studies of Elementary Stages of Enzymatic Catalysis Alexander Nemukhin Department of Chemistry M.V. Lomonosov Moscow State University Russian Federation N.M. Emanuel Institute of Biochemical Physics Russian Academy of Sciences The aim is to study mechanisms of chemical reactions in complex molecular environment by considering J. Phys. Chem. ... Chem., ... Modeling, 2005, 11, 503 Grigorenko B., Rogov A., Nemukhin A. // J. Phys. Chem. ...

Еще в разделе: (Показать все результаты (>20) - lcc.chem.msu.ru/ )

• Research Interests
• People

... Hittite-Luvian Bilingualism and the Origin of Anatolian Hieroglyphs' . ... Journal of Ancient Near Eastern Religions 5 (2005): 107-37. ... Wiesbaden: Harassowitz, 2005, pp. ... Moscow: Languages of Slavonic Culture, 2002, pp 93-116. ... Proceedings of the Nineteenth Annual UCLA IE conference (ed. K. Jones-Bley et al.) Washington, DC: Institute for the Study of Man, 2008, pp. ... Proceedings of the Seventeenth Annual UCLA IE conference , Los-Angeles, October 27-28, 2005 (ed. K. Jones-Bley et al.) ...

Еще в разделе: (Показать все результаты (>22) - imk.msu.ru/ )

• Vyach. Vs. Ivanov. Institute of World Culture
• Институт мировой культуры МГУ
• Институт мировой культуры МГУ. Отдел лингвокультурной экологии

... With the usage of on-land and satellite altimetrical measurements data some gravity map were made, averaged on one degree trapeziums, in reductions Faja, Bouguer, Glenni, which were included in the geological-geophysical international atlases of Atlantic, Indian and Pacific oceans. ... Boldirev S.A., Gajnanov A.G., Stroev P.A. Dencital inhomogeneities in lithosphere and dynamics of development of the North-West part of the Pacific mobile belt. ... Moscow, Nedra edition, 1967. ...

Еще в разделе: (Показать все результаты (>60) - geophys.geol.msu.ru/ )

• TES. Conclusion
• Anis. Page 10
• TES tecnology. MSU.

... Department of Computational mathematics and cybernetics , Lomonosov Moscow State University . ... Thesis title "Machine learning approach for automatic performance tuning of parallel program", supervisor Dr. Nina N. Popova. ... High-performance computing, automatic performance tuning, machine learning algorithms, evolutionary and bio-inspired programming, parallel algorithms in VLSI design . ... Algorithms and framework for automatic selection and tuning parameters of parallel sparse linear solvers....

Еще в разделе: (Показать все результаты (>4) - angel.cmc.msu.ru/ )

Вы посетили: conf_engl.html . ... International Algebraic Conference dedicated to 70th birthday of professor A.V. Mikhalev, Russia, Moscow, November 2010 . ... International Algebraic Conference dedicated to the 100-year anniversary of professor A.G. Kurosh, Russia, Moscow, May 2008 . ... 2nd International Conferences on Matrix Methods and Operator Equations, Russia, Moscow, July 2007 . ... staff/guterman/conf_engl.html.txt Последние изменения: 13.02.2013 11:26 (внешнее изменение) | ...

Еще в разделе: (Показать все результаты (>26) - halgebra.math.msu.su/ )

• staff:guterman:conf_rus.html | Кафедра высшей алгебры
• staff:guterman:inv_engl.html | Кафедра высшей алгебры
• staff:guterman:activ_rus.html | Кафедра высшей алгебры

Shipunov A.B. Systema Angiospermarum [Electronic resource]. 1991 onwards. ... Current version: . Classification , PDF (version information inside) . ... Version 5.1 , PDF, used in: Shipunov A., Reveal J.L. Validation of subordinal names for "Systema Angiospermarum" // Phytotaxa. ... Version 4.977 , PDF, used in: Reveal J.L. Summary of recent systems of angiosperm classification // Kew Bulletin. ... The system is traditional: it means that paraphyletic taxa are widely (but not elsewhere) accepted. ...

Еще в разделе: (Показать все результаты (>233) - herba.msu.ru/ )

• Algologia
• BIOL 310: Ethnobotany
• Georg Franz Hoffmann

... distant.msu.ru . ... Видеоархив МГУ . Список курсов . ... Курсы факультетов МГУ . Факультет мировой политики . ... Курсы для школьников / Курсы от школ-партнеров / ГБОУ Гимназия ?1272 Курсы для школьников / Курсы от школ-партнеров / ГБОУ Гимназия ?1516 Курсы для школьников / Курсы от школ-партнеров / ГБОУ СОШ ?1159 Курсы для школьников / Курсы от школ-партнеров / ГБОУ Школа ?2065 Курсы для школьников / Курсы от ... Открытые курсы МГУ . ...

Еще в разделе: (Показать все результаты (>2) - distant.msu.ru/ )

... Registration and Abstract submission are open for the International Conference on Physics Education ICPE 2014 , that will take place at the Sheraton Cordoba Hotel & Convention Center, C rdoba, Argentina, on August 18th to 22th, 2014. ... Keynote Speaker: Cedric Linder , Professor of Physics Education Research, Division of Physics Education Research, Department of Physics and Astronomy, Uppsala University, Sweden. ... Prof. Zulma Gangoso (Chair) . ... Prof. Zulma Gangoso (Argentina) . ...

Еще в разделе: (Показать все результаты (>46) - foroff.phys.msu.ru/ )

• Key research directions
• Faculty's Tuition Structure

... ATCC 33913, section 162 of 460 of the complete genome. ... Identities = 162/314 (51%), Positives = 214/314 (68%), Gaps = 2/314 (0%) Frame = -2 Query : 27 ASLTGAGATFPAPVYAKWADTYQKETGNKVNYQGIGSSGGVKQIIANTVDFGASDAPLSD 86 A + GAGA+F P+ +KW+ Y TGNKVNYQ IGS GG+ QI A TVDFG+SD PL Sbjct : 1031 AEIAGAGASFIYPLVSKWSADYNAATGNKVNYQSIGSGGGIAQIKAGTVDFGSSDKPLDS 852 Query : 87 EKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKIKKWDDEAIAKLNP 146 +L Q GL QFP+ IGGVV VNI G+ G+L L G LGDI+LGK+ W+D AIA NP ...

Еще в разделе: (Показать все результаты (>1277) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/FBB/year_03/doc/help_14.doc
• UniProt fields
• Поисковые системы

... Department of Mathematical Physics . ... Springer: Журналы . Springer: Книги . ... Журнал Science . ... Журналы American Physical Society . ... Журналы NPG (Nature Publishing Group) . ... Журналы The American Mathematical Society . Журналы The Royal Society Publishing . ... The Royal Society Publishing (GreatBritain) . ... the Royal Society A: Mathematical, . ... the Royal Society B: Biological Sciences . Proceedings of the Royal Society A: Mathematical, Physical & Engineering Sciences . ...

Еще в разделе: (Показать все результаты (>64) - mph.cmc.msu.ru/ )

... Astronomy search engine . ... PhysicsWeb Home Page . ... Sternberg Astronomical Institute . ... Astro Space Center Home Page . ... Landau Institute for Theoretical Physics . ... Astronomy and Space Physics Dept of Kiev University . ... NATIONAL RADIO ASTRONOMY OBSERVATORY Home Page . University of Hawaii - Institute for Astronomy . ... Space Telescope Science Institute Home Page . ... Sky & Telescope: The Essential Magazine of Astronomy . ... Springer LINK - Physics Online Library . ... Home . ...

Еще в разделе: (Показать все результаты (>213) - astro.uni-altai.ru/ )

... ICONO Invited Speakers . ... Gennadiy Kulipanov, Budker Inst. of Nuclear Physics, Russia . ... Marlan Scully, Texas A&M Univ., ... Andrey Goncharov, Inst. of Laser Physics, Russia . ... Vladimir Trunov, Inst. of Laser Physics, Russia . ... Since 1987, he has worked at the National Research Council of Canada (Ottawa) in the field of laser physics and trapped ion optical frequency standards. ... Alexey Taichenachev , Inst. of Laser Physics, Russia . ... S. Vatnik, Inst. of Laser Physics, Russia . ...

Еще в разделе: (Показать все результаты (>13) - iconolat13.phys.msu.ru/ )

• Foreword

... The RADEN data bank produced at the Department of Chemistry of Moscow State University is designed as well to accumulate published information on radiative parameters of diatomic molecules, as to analyse it and recommend the more reliable values. ... electronic transition moments D ( R ); . ... dipole moments, . ... FACTUAL RECOMMENDED DATABASE contains now the ab initio and experimental electronic transition moments for more than 250 band systems which belong to more than 100 diatomic molecules. ...

Еще в разделе: (Показать все результаты (>95) - electr003.chem.msu.ru/ )

• Theory as a Lighthouse in the Electrochemical Ocean
• Pages of history
• Frumkin Institute, Theoretical Department

npidb:// home / introduction . Russian version of this document . The database NPIDB (Nucleic acid ? Protein Interaction DataBase) contains information derived from structures of DNA-protein and RNA-protein complexes extracted from Protein Data Bank (PDB) (1932 complexes in the end of 2007). ... Provide an essential information on structural features of DNA-protein and RNA-protein interaction for the users who need to get acquainted with the problem. ... NPIDB . ...

Еще в разделе: (Показать все результаты (>218) - monkey.belozersky.msu.ru/ )

• PDB entries containing domains of the family "POU domain, class 2, associating

... Professional experience . ... Department of Geology. Chair of Dynamic Geology. ... Laboratory of Geodynamic Processes Modeling. ... 2001 Elaboration (together with V.Vadkovsky ) electronic version of textbook on course "Dynamic Processes in Geology" for students of 5th course and postgraduate students (MSU. ... 2000 - Delivering lectures and performing exercises with students on the course "Computer Simulation Of Geodynamic Processes" for students of 3rd course (MSU. ... Page design: їV.Zakharov . ...

Еще в разделе: (Показать все результаты (>26) - dynamo.geol.msu.ru/ )