GENERATION OF PARTICLES IN VACUUM IN PRESENCE OF STRONG ELECTROMAGNETIC FIELDS S. A. SMOLYA NSKY ? ... The process of particle-antiparticle pairs generation in the presence of strong electromagnetic fields is described, using the simplest models of physical vacuum. ... Further we discuss the latest works on kinetic description of the process of particles generation in vacuum in the presence of strong non-stationary fields. ­ . 2001 =c m c +p . ... 2mc2. - - , 2mc2 2 (-) (-) . ... kin , Vmax . ...

Еще в разделе: (Показать все результаты (>173) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/210809/nesterenko.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/210809/Teryaev_lom09.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/220809/Demidov.pdf

... 2013-03-19 02:34 . ... index.htm . ... 1.1M . ...

Еще в разделе: (Показать все результаты (>419) - herba.msu.ru/ )

• Systema Naturae
• Moscow State University, Geobotany dpt. - Restore
• The employment of quantitative methods for the lake ecosystem research

... Parent Directory - 1-1-GeneralTopology-Conspectus-2009.pdf 26-Aug-2009 19:49 189K 1-1-GeneralTopology-Conspectus-Addendum-5-5-2009.pdf 09-Sep-2009 12:56 131K 1-4-Examples-Addendum.pdf 22-Sep-2009 11:50 89K Alexandrov-168-169.pdf 08-Sep-2009 12:36 225K ControlWorks/ 05-Sep-2009 15:50 - FAQ/ 08-Sep-2009 13:53 - Poincare.pdf 08-Nov-2007 15:29 296K Program-2009.pdf 16-Aug-2009 12:31 89K Test1-2009.pdf 28-Aug-2009 15:42 83K UchPr-2009.htm ...

Еще в разделе: (Показать все результаты (>304) - higeom.math.msu.su/ )

• C*-algebras: Talks

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>121) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 4/2014

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>18) - antares.sinp.msu.ru/ )

About SPAW Editor . ... As of final version 1.0 of the control you'll need to rename the file spaw_control.default.config.php in config sub-directory to spaw_control.config.php when installing control for the first time. ... All of the SPAW Editor configuration options are located in the config/spaw_control.config.php file. ... This file will be included in img_library.php (Image library dialog script). $request_uri variable will be set to the URL of the page where SPAW Editor instance resides. ...

Еще в разделе: (Показать все результаты (>81) - textbook.sinp.msu.ru/ )

• Index of /modules/ax_content/atomax
• Index of /modules/ax_content/atomax/img

... Stress-Dependent Complementary Variations in P- and S-Wave Velocities for Rocks Containing   High-Compliance Porosity: an Effective-Medium Model and Comparison with Experiments . ... A 3D effective-medium model describing variation in rock elastic moduli due to presence of high-compliant defects is considered. ... The ratio of the normal-to-shear compliance of the defects was determined for different rock samples. The results confirmed that, in saturated rocks, defect’s shear compliance dominates. ...

Еще в разделе: (Показать все результаты (>311) - acs366.phys.msu.su/ )

Calcareous paleosols are widely distributed throughout the arid and semi arid regions of the world. These paleosols have been described from virtually every continent of the world, yet there is no internationally agreed upon nomenclature for the description of the horizons present within them. ... This abstract proposes the adoption of a universally agreed-upon system of horizon designation and gross morphological description of calcareous paleosols. ... Soil Science, 101, 347-360. ...

Еще в разделе: (Показать все результаты (>292) - www.fadr.msu.ru/ )

• Foundation for Agrarian Development Research - Services - Portfolio
• D.N.Durmanov OPENING WORD
• NEW FARM RESOLUTION (From RUSAG conference)

Arthropoda Selecta 22(3): 265266 ї ARTHROPODA SELECTA, 2013 Larinioides folium (Schrank, 1803) is a valid species name (Aranei: Araneidae) Larinioides folium (Schrank, 1803) валидное название (Aranei: Araneidae) K.G. Mikhailov К.Г. Михайлов Zoological Museum MGU, Bolshaya Nikitskaya Str. ... The validity of the spider name Aranea folium Schrank, 1803, now Larinioides folium, is confirmed. ... Подтверждена валидность видового названия паука Aranea folium Schrank, 1803, ныне Larinioides folium. ...

Еще в разделе: (Показать все результаты (>1513) - zmmu.msu.ru/ )

• http://zmmu.msu.ru/files/images/spec/Russ%20Ent%20J/ent21_3%20315_317%20Sokolov%20for%20Inet.pdf
• Definition of the type material of several nominal taxa of pikas (Lagomorpha:
• Late Miocene Indarctos punjabiensis atticus (Carnivora, Ursidae) in Ukraine

Ultrafast Faraday Rotation In Magnetophotonic Microcavities Alexandr I. Musorin1, Margarita I. Sharipova1, Artem V. Chetvertukhin1, Tatyana V. Dolgova1, M. Inoue2, Andrey A. ... Hibarigaoka- - Tenpakucho, Toyohashi, Aichi Prefecture 441-8122, Japan musorin@nanolab.phys.msu.ru Abstract: Femtosecond dynamics of Faraday effect in magnetophotonic microcavities is experimentally demonstrated by using polarization-sensitive correlation scheme ...

Еще в разделе: (Показать все результаты (>81) - nanolab.phys.msu.ru/ )

• http://nanolab.phys.msu.ru/sites/default/files/dicnma.pdf
• http://nanolab.phys.msu.ru/sites/default/files/paper_1.pdf
• Ultrafast plasmonics and magnetoplasmonics | Laboratory of Nanophotonics &

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>7) - storage.bioinf.fbb.msu.ru/ )

CONTENTS Foreword (Edward Roslof-Tatiana Venediktova) Oksana Gavrishina Everyday Life in the Plural Case "Just Life": Reading and Description |George Perec|Addressing the Ordinary. ... Olga |Noone and Anyone: The Ordinary | ... Anna |" ... Trakhtenberg|eternity": Russian and American| ... Boris Dubin |Weekdays and Holidays in Soviet| | ... Elena |Ordinary Life in Biography and | ... Reality for Every Day |Bret |Empire Embedded: Reality TV | ... Thing | ... Anna |The Status of "Thing" in the | ...

Еще в разделе: (Показать все результаты (>344) - www.philol.msu.ru/ )

• FDSL-7.5 | Home
• LangueDOC :: Archi :: Alphabet

Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales (Описание ролей Проппа в русской волшебной сказке) // Обработка текста и когнитивные технологии: сб. статей. ... 19: Труды XII Международной научной конференции (Дубровник, 7-14 сентября 2010 г.). Казань: Казан. гос. ун-т, 2010 (реально сборник вышел в 2011 г.). С. 77-79. ...

Еще в разделе: (Показать все результаты (>123) - srcc.msu.ru/ )

• Kazakevich, Olga. Endangered Languages Documentation and Description: Should
• Kazakevich, Olga. Documentation and description of the Northern Selkup local
• V.V.Pipin, D.D.Sokoloff The fluctuating $\alpha$-effect and Waldmeier relations

... Лаборатория теоретической биофизики . ... This PyMol script is capable of generating a set of a molecule?s conformations, which can be further used to calculate their potential energy or any other properties. The script enables one to vary several internal degrees of freedom (DOFs) synchronously as well as scanning over a multidimensional grid in a space of DOFs. ... Нет комментариев " PyMol script for scanning potential energy surfaces " . ... 2013 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>31) - erg.biophys.msu.ru/ )

• Quantum chemistry information page ERG Research Group: Лаборатория
• Normal modes visualization for PyMol ERG Research Group: Лаборатория
• toolset ERG Research Group: Лаборатория теоретической биофизики

... Present position: Associate Professor, Physics Department, Moscow State University 6. ... Education: Graduated from Physics Department of Moscow State University in 1987. ... Research interests: statistical physics of macromolecules, theory and simulation of polymeric liquid crystals, computer simulations of polymer systems, copolymers, stiff-chain macromolecules, conformation-dependent sequence design of AB-copolymers, biopolymers, computer simulation of polymer dynamics. ...

Еще в разделе: (Показать все результаты (>262) - polly.phys.msu.ru/ )

• Seminar in Polymer Physics
• P.N.S.P.M. Lab. - Research
• Science

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ... As colored columns of the alignment. ...

Еще в разделе: (Показать все результаты (>408) - monkey.belozersky.msu.ru/ )

• SDP home page
• Inquiry information || Parsimony algorithm
• SCOP famyli:

... Микс 193 A 131 A 171 A 211 A 304 A Корона Магнитограмма . 211 + 193 + 171 . Description . ... LASCO (Large Angle and Spectrometric Coronagraph)- инструмент на космическом аппарате SOHO, поставляющий изображения солнечной короны, на которых свет, идущий непосредственно от Солнца, заблокирован с помощью искусственного затмения, создаваемого самим аппаратом. ... The form and the location of the magnetospheric boundary are defined by pressure balance of the solar wind and geomagnetic field. ...

Еще в разделе: (Показать все результаты (>1233) - swx.sinp.msu.ru/ )

Physics ± Uspekhi 58 (12) 1220 ± 1222 (2015) LETTERS TO THE EDITORS #2015 Uspekhi Fizicheskikh Nauk, Russian Academy of Sciences PACS numbers: 05.45. ± a, 45.40. ± f Notes on new friction models and nonholonomic mechanics A V Borisov, I S Mamaev DOI: 10.3367/UFNe.0185.201512g.1339 Abstract. ... Using recent results as examples, it is shown that the validity and potential of the nonholonomic model are not inferior to those of other dynamics and friction models. ... 226 2831 (2015) Borisov A et al. ...

Еще в разделе: (Показать все результаты (>122) - ics.org.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>15) - tukachev.flogiston.ru/ )

• Category: Новости

MSU . Science Park . ... Venue & Space . ... At Moscow State University Science Park, the laboratory and administrative offices are available to hire by innovative companies on a long or short term basis. ... MSU Science Park is situated in a picturesque area of Moscow, close to the MSU Botanical Garden on Sparrow Hills. With eight, two-storey buildings of 500 m 2 each on the site plus a four-storey building with an area of 7,500 m 2 , there is a total building area of 11,500 m 2 . ...

Еще в разделе: (Показать все результаты (>7) - www.sciencepark.ru/ )

• MSU Science Park - About us