Head of sector, acting head of the Computational Geophysics Division of the M.V. Keldysh Institute for Applied Mathematics, RAS. ... Finished the Electrodynamics and Quantum Theory Department of Faculty of Physics, MSU in 1962. ... Ill-posed problems, stochastic processes, theory of approximation. Mechanics and physics of multi-phase media, phenomena in porous media, difference schemes for some classes of mathematical physics problems (filtration, elasticity theory). ...

Еще в разделе: (Показать все результаты (>3) - compmech.math.msu.su/ )

Head of the project: . ... Deputy head on the scientific program: . ... Head of the "Space Laboratory Work" . ... Postal address: Leninskie Gory, SINP MSU, Moscow, 119992, Russia, project "MSU-250" . ...

Еще в разделе: (Показать все результаты (>34) - cosmos.msu.ru/ )

About Department of Crystallography and Crystal Chemistry . Department of Crystallography and Crystal Chemistry was founded in Lomonosov Moscow State University by Correspoding Member of USSR Academy of Sciences Prof. G.B. Bokii in 1949. ... During all the time X-ray crystal structure determination of new minerals and their synthetic analogues remains the major part of scientific researches of the Department. ... Prof. N.N. Eremin), X-ray diffraction and crystal structure analysis (Prof. D.Yu. ...

Еще в разделе: (Показать все результаты (>27) - cryst.geol.msu.ru/ )

. Warning : Cannot modify header information - headers already sent by (output started at /wcmc/ndsipu/ndsipu/phpthumb/phpthumb.class.php:3947) in /wcmc/ndsipu/ndsipu/student.php on line 84 .

Еще в разделе: (Показать все результаты (>2) - ndsipu.cmc.msu.ru/ )

Specific features of high-speed flight aerodynamics: computer simulation of hypersonic flow around the head of an object" . Tarnavsky G.A., Aliev A.V. A one of the specific features of hypersonic flow around the blunted head of an object discovered by the computer simulation of aerodynamics of high-speed flight and called the "carbuncle effect" is studied. ... Key words: aerodynamics, hypersonic flow, carbuncle effect, computer simulation . ...

Еще в разделе: (Показать все результаты (>177) - num-meth.srcc.msu.ru/ )

• Supercomputer molecular modeling of thermodynamic equilibrium in gas-metal
• Methods and concepts of vortex flow visualization in the problems of
• Editorial Board

. Laboratory Head: L.K.Gladilin, tel: (+7 495) 939 3568 , fax: (+7 495) 939 3064 , . Сотрудники Лаборатории (LHPR staff) . Web-pages: . L.K.Gladilin , . V.I.Rud , . I.A.Korzhavina , . Information for our Guests . Справка о создании и первом периоде работы лаборатории, подготовленная в 1980 г. Research Activities: . Scientific Information Search Engines : inSPIRE , ScienceResearch , Google Scholar . Scientific Servers : Interactions , AIP , Elements , Scientific . Feedback: Last modified on March 1, 2016.

Еще в разделе: (Показать все результаты (>10) - lhe.sinp.msu.ru/ )

... List of complexes . List of structures of RNA-protein and DNA-protein complexes . ... Experimental method: all X-RAY DIFFRACTION SOLUTION NMR ELECTRON MICROSCOPY FIBER DIFFRACTION SOLUTION NMR; THEORETICAL MODEL SOLUTION NMR; SOLUTION SCATTERING . Kind: all rna dna hybrid . ... HYDROLASE/DNA . X-RAY DIFFRACTION . ... dna . ... RNA BINDING PROTEIN/RNA . ... rna . ... HYDROLASE/RNA/DNA . ... HYDROLASE/RNA . ... TRANSFERASE/RNA/DNA . ... TRANSFERASE/DNA/RNA . ... NPIDB team 2003 - 2016 . ...

Еще в разделе: (Показать все результаты (>7) - npidb.belozersky.msu.ru/ )

• NPIDB: 5DPK structure

... The international conference " Differential Equations and Topology " devoted to the 100th Anniversary of the birthday of Lev Semenovich Pontryagin was held in Lomonosov Moscow State University, June 17-22, 2008. Head of the ASR Department RAS Corresponding Member Dmitry P. Kostomarov had a talk "Problems for Ultrahyperbolic Equations in Half-Space" [ PDF 413.47 KB ] on June 22nd at the subsection "Partial Differential Equations" of "Differential Equations" section. ...

Еще в разделе: (Показать все результаты (>6) - ani.cs.msu.su/ )

• The ASR Department at the CMC Faculty of Lomonosov MSU

... The gravity and magnetics' laboratory (V.R.Melikhov), . The laboratory of Electrical survey, which includes three groups: . ... EM methods (V.K.Khmelevskoy, A.G.Jakovlev), . ... The laboratory of Engineering geophysics (A.A.Ogilvy, V.A.Bogoslovsky and E.N.Kuzmina) . The head of geophysical department is Prof. V.K. Khmelevskoy . 119899, Russia, Moscow, Moscow State University, Geological Faculty, Department of Geophysics . ... Tel. & fax: (7-095) 939 49 63 . ...

Еще в разделе: (Показать все результаты (>54) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

... Sun , 19 Dec 2010 19:49:53 GMT Daniil Alexeyevsky me.dendik@тАж [41:bcad0f5464bf] * snake.py ( modified ) snake.Rule.load: give reasonable error rather than crash on empty lines Sun , 19 Dec 2010 19:46:39 GMT Daniil Alexeyevsky me.dendik@тАж [40:94945f11c78d] * snake.py ( modified ) snake.Snake.fill: tail takes precedence over body head Sun , 19 Dec 2010 19:45:31 GMT Daniil ...

Еще в разделе: (Показать все результаты (>610) - kodomo.cmm.msu.su/ )

• http://kodomo.cmm.msu.su/trac/snake/log/?format=changelog&rev=57%3A2f62804e21fc&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/?format=changelog&rev=58%3Ab46dd72b6afe&limit=100&mode=stop_on_copy
• http://kodomo.cmm.msu.su/trac/snake/log/?format=changelog&rev=b46dd72b6afeb49e9154d11d1550293b5bcf7a07&limit=100&mode=stop_on_copy

My Teachers . Kh.A. Rakhmatulin . ... U.M. Dubova-Sergeeva . ... Kh.A. Rakhmatulin's works reflect a wide range of his scientific interests. Fundamental results, obtained by him, have a great scientific and applied significance in many fields of modern mechanics: . ... Meritorious Art Worker of Russia Undina Mikhailovna Dubova-Sergeeva was founder and head of M.Lomonosov Moscow State University Piano Class, from 1936 till 1986. ...

Еще в разделе: (Показать все результаты (>3) - margaret.imec.msu.ru/ )

... D., Full Doctor of Biological Science, Professor, Corresponding Member of the Academy of Sciences of Russia, Head of Biophysics Department, Faculty of Biology, Moscow State University. ... Moscow 119899, Moscow State University, Faculty of Biology, department of Biophysics. ... 1954 -1959 - Student of Biological faculty, Dep. of Biophysics, Moscow State University. 1976 till now - Head of Chair of Biophysics, Faculty of Biology, University of Moscow, Moscow 119899. ...

Еще в разделе: (Показать все результаты (>7) - biophys.msu.ru/ )

January 5, 1999 - Our Hitting motions were recorded by Head Coach on a video tape for comparing with Ken Griffey jr, Jay Buhner, Edgar Martinez and Bernie Williams's motions. January 6, 1999 - the Same thing . January 8, 1999 - I'm just talked with my teammate Garik about Web Page, and I began a work. ... January 13, 1999 - We watched a video tape with comparing of motions. ... Head Coach made a video tape with us on a work out for them. ... March 9, 1999 - Hitting wothout pitching machine. ...

Еще в разделе: (Показать все результаты (>3) - mguteam.chat.ru/ )

• http://mguteam.chat.ru/komiss1.html
• http://mguteam.chat.ru/roster1.html

NGS Data Analysis with Unipro UGENE Olga Golosova, Yuriy Vaskin, German Grekhov, Yuliya Algaer UNIPRO, Lavrentieva ave. ... That is where Unipro UGENE NGS framework comes in play. ... Moreover, the UGENE toolkit allows one to automate common tasks by creating workflows with the integrated tools using the UGENE Workflow Designer. Analysis of NGS data with UGENE may start, for example, from quality control of raw NGS data, received from a sequencing facility, with the integrated FastQC [3] tool. ...

Еще в разделе: (Показать все результаты (>167) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/39.pdf

... Актовый зал (Большая Аудитория) . Актовый зал был задуман Казаковым как центр всего университетского ансамбля, "святилище муз", а его увенчанная куполом ротонда, судя по другим аналогичным композициям зодчего, непосредственно соответствовала церковному пространству. ... Традиция публичных лекций в университете ведется от самого его основания, достаточно сказать, что здесь происходили знаменитые публичные лекции по всеобщей истории Т.Н.Грановского , бюст которого находится сейчас в этом зале. ...

Еще в разделе: (Показать все результаты (>107) - museum.guru.ru/ )

• История Императорского Московского университета :: Главный корпус Университета
• История Императорского Московского университета :: Уставы :: Предисловие
• История Императорского Московского университета :: Библиотека :: Воспоминания

... Moskovsky Alexander . ... Rogov Alexander . Modeling the reaction of hydrolysis of peptide bonds by trypsin by using quntum mechanical - molecular mechanical methods . ... Title: "Modeling Spectra of Molecular Clusters by Quantum Chemistry and Molecular Dynamics Methods" . ... Title: "Development of the Combined Quantum Mechanical - Molecular Mechanical Methods" . ... Title: "Modeling mechanisms of enzymatic hydrolysis reactions by the combined quantum mechanical - molecular mechanical methods" . ...

Еще в разделе: (Показать все результаты (>4) - lcc.chem.msu.ru/ )

... American), headings and the style of referencing. ... The opening page of a contribution in the NATO book series should always be a right hand page and should consist of: the title in capital letters, bold font, flush left, on the fourth text line; followed by the subtitle (if present) in italics, flush left, with one line of white above. ... First-order Heading This heading is in bold, upper and lowercase letters, numbered in arabic figures, and has two lines of space above and one line below. ...

Еще в разделе: (Показать все результаты (>84) - mgumus.chem.msu.ru/ )

• MGUMUS -- Persons
• List of participants
• IHSS-14

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>34) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... Structure of Data . ... Catalog . ... The SAI OCL Catalog site provides several VO-enabled modes of operation: . VO-enabled catalog data analysis from a browser . ... Endpoint URL is http://ocl.sai.msu.ru/catalog/conesearch/ . ... VO-enabled catalog analysis from a browser . Presently, this recipe works with Firefox (Windows, MacOS, Linux), Internet Explorer (Windows) and Opera (Windows) browsers with Java plugin 1.6 installed. ... Main TOPCAT window with SAI OCL catalog loaded will appear. ...

Еще в разделе: (Показать все результаты (>2) - ocl.sai.msu.ru/ )

... Hittite-Luvian Bilingualism and the Origin of Anatolian Hieroglyphs' . ... Journal of Ancient Near Eastern Religions 5 (2005): 107-37. ... Wiesbaden: Harassowitz, 2005, pp. ... Moscow: Languages of Slavonic Culture, 2002, pp 93-116. ... Proceedings of the Nineteenth Annual UCLA IE conference (ed. K. Jones-Bley et al.) Washington, DC: Institute for the Study of Man, 2008, pp. ... Proceedings of the Seventeenth Annual UCLA IE conference , Los-Angeles, October 27-28, 2005 (ed. K. Jones-Bley et al.) ...

Еще в разделе: (Показать все результаты (>16) - imk.msu.ru/ )