. Please standby and you will be automatically connected to the new location of the unframed Supernova page. Or, click on the link above. If you have questions or problems, please email me at David Bishop dbishop@vhdl.org . Last modified: Mon Aug 27 12:40:15 EDT 2001

Еще в разделе: (Показать все результаты (>416) - www.rochesterastronomy.org/ )

Asymptotic behavior of form factor of the composite system at large momentum transfer. ... Comparison of predictions CQM and pQCD for the pion in the Instant form of relativistic quantum mechanics The electromagnetic current matrix element for pion: p | ... Asymptotic behavior of the pion form factor for Q 2 · Pointlike quarks: d d u u GE (Q 2 ) + GE (Q 2 ) = 1, GM (Q 2 ) + GM (Q 2 ) = 1 Ї Ї F (Q 2 ) quarks: 25/2 M - e Q QM 4b 2 1+ 7b2 2MQ . ...

Еще в разделе: (Показать все результаты (>128) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks/QFTHEP2011.pdf
• http://qfthep.sinp.msu.ru/talks/kinks1.pdf
• http://qfthep.sinp.msu.ru/talks2015/1435258212_Krutov_Polezhaev_Troitsky1_2015.pdf

... REVIEWS Measurement and Physical Content of Quantum Information B. A. Grishanin and V. N. Zadkov Received January 15, 2002 Abstract--Basic quantum information measures involved in the information analysis of quantum systems are considered. ... But today, it has become possible to intentionally vary directly quantum states of elementary quantum systems. ... 9 2002 MEASUREMENT AND PHYSICAL CONTENT OF QUANTUM INFORMATION 935 its information-equivalent copy is at the input and output. ...

Еще в разделе: (Показать все результаты (>78) - qilab.phys.msu.ru/ )

• http://qilab.phys.msu.ru/papers/PRA22309.pdf
• Quantum Information Lab, Int'l Laser Ctr. and Faculty of Physics, M.V.Lomonosov

... Abstract Description of the whole sorption preconcentration step was proposed based on a system of equations comprising equations of mass balance, external diffusion mass transfer and equilibrium distribution of analyte. ... Moscow University Chemistry Bulletin . 2009, Vol. ... 4, P. 238 . Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ... Web-design: Copyright (C) MIG and VVM . ...

Еще в разделе: (Показать все результаты (>477) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 43, No. 3, P. 139 (2002)
• PC Crystal Chemistry Analysis of Organic Crystal Structures
• Entrance Examinations - Preliminary Round

... It is shown that theoretical methods developed for description of hopping transport in disordered inorganic solids, such as amorphous semiconductors, can also be successfully applied to description of hopping transport in organic disordered systems, such as conjugated or molecularly doped polymers. We concentrate our discussion on percolation approach and show its universal applicability to systems with different distributions of localized state energies. ...

Еще в разделе: (Показать все результаты (>51) - scon155.phys.msu.su/ )

• Generalized pair approximation in the description of ate AC conductivity of a

Doxyfile 1.4.6-NO # This file describes the settings to be used by the documentation system # doxygen (www.doxygen.org) for a project # # All text after a hash (#) is considered a comment and will be ignored # The format is: # TAG = value [value, .. ... USE_WINDOWS_ENCODING = YES # If the BRIEF_MEMBER_DESC tag is set to YES (the default) Doxygen will # include brief member descriptions after the members that are listed in # the file and class documentation (similar to JavaDoc). ... The default is NO. ...

Еще в разделе: (Показать все результаты (>11) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/files/courses/ipintro2012/Lec_Pt2_MATLAB_Workshop_SHORT.pdf
• http://imaging.cs.msu.ru/pub/2013.PRIA.Mamaev_Lukin_Yurin.HermiteNLM.en.pdf

... They elected her to represent them on the committee. 4.to lose elections ­ to receive an amount of money paid by government or company, to someone who can no longer earn money by working. ... The government must introduce new tough policies to reduce unemployment. 8.to give glimpses ­ a person who travels from place to place and holds religious meetings in the open air to persuade people to become Christians. ... Most students have to stretch their money while studying away from home. ...

Еще в разделе: (Показать все результаты (>20) - www.eng.math.msu.su/ )

... This applet generates an observing list based on an observer's location and time. ... To use this program, enter in your location, and the local times at which you wish to begin and end observing. The date you enter should correspond to the calendar day at the time at which you begin observing. For example, if you wish to observe from 9:37 PM October 23, 2007 until 3:21 AM October 24, 2007, you would enter 21:37 for the starting time, 03:21 for the finish time, and 10/23/2007 for the date. ...

Еще в разделе: (Показать все результаты (>17) - observ.pereplet.ru/ )

... Parent Directory - 1-1-GeneralTopology-Conspectus-2009.pdf 26-Aug-2009 19:49 189K 1-1-GeneralTopology-Conspectus-Addendum-5-5-2009.pdf 09-Sep-2009 12:56 131K 1-4-Examples-Addendum.pdf 22-Sep-2009 11:50 89K Alexandrov-168-169.pdf 08-Sep-2009 12:36 225K ControlWorks/ 05-Sep-2009 15:50 - FAQ/ 08-Sep-2009 13:53 - Poincare.pdf 08-Nov-2007 15:29 296K Program-2009.pdf 16-Aug-2009 12:31 89K Test1-2009.pdf 28-Aug-2009 15:42 83K UchPr-2009.htm ...

Еще в разделе: (Показать все результаты (>281) - higeom.math.msu.su/ )

• Index of /~asmish/Lichnaja-2010/Version2010-11-20/Trudy/Publications/2004
• C*-algebras: Talks

... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>47) - sn.sai.msu.ru/ )

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>98) - vestnik.math.msu.su/ )

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>14) - antares.sinp.msu.ru/ )

... Женский клуб . ... Издательство МГУ . ... Сотрудники Университета Лаваль, Университетского госпиталя Квебека и компании GlaxoSmithKline заявляют: им удалось подойти вплотную к получению вакцины против болезни Альцгеймера, пишет The Best medical cover . Ученые выделили молекулу MPL, на которую они, как раз, делают основную ставку. ... The molecule, known as MPL (monophosphoryl lipid A), has been used extensively as a vaccine adjuvant by GSK for many years, and its safety is well established. ...

Еще в разделе: (Показать все результаты (>131) - www.moscowuniversityclub.ru/ )

... The first line of each paragraph should be indented by 0.63 cm except for paragraphs that follow a white space (e.g., after a heading, example, table or figure). ... References to examples in the text should take the form "see (1a) and (1b)" with both number and letter in brackets. ... 2.6 Pagination There should be no orphaned example numbers, that is, example numbers with corresponding text on the following page; page breaks in definitions or between examples and glosses, etc. ...

Еще в разделе: (Показать все результаты (>294) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/fdsl/FDSL7.5-stylesheet.doc
• FDSL-7.5 | Home

... Mathematical models and methods in VLSI design . ... General models and statements about the complexity of combinatorial tasks, methods for development of fast algorithms (method of dynamic programming, ?divide and conquer?, ?method of model extension?) are considered. ... Mathematical models of contemporary electronic circuits are considered and basic approaches to solving task of logic synthesis, as well as tasks of VLSI modules placement and interconnection routing are described. ...

Еще в разделе: (Показать все результаты (>10) - hcs.cmc.msu.ru/ )

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>14) - comphep.sinp.msu.ru/ )

• extra:model:main [CompHEP]

.

Еще в разделе: (Показать все результаты (>12) - hep.msu.dubna.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... When embedded within a base document, a URL in its absolute form may contain a great deal of information which is already known from the context of that base document's retrieval, including the scheme, network location, and parts of the url-path. ... Introduction This document describes the syntax and semantics for "relative" Uniform Resource Locators (relative URLs): a compact representation of the location of a resource relative to an absolute base URL. ... 3.1) Base URL embedded in the | ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2396.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1945.txt

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>56) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page2