... 2001 Current concepts in cell death . Zhivotovsky B. , Orrenius S. в журнале Current protocols in cell biology / editorial board, Juan S. Bonifacino ... [et al.] , издательство John Wiley & Sons Inc. ...

Еще в разделе: (Показать все результаты (>901) - istina.msu.ru/ )

• Nature Protocols - журнал | ИСТИНА - Интеллектуальная Система Тематического
• Current protocols in nucleic acid chemistry - журнал | ИСТИНА -
• Current protocols in chemical biology - журнал | ИСТИНА - Интеллектуальная

install ]] . ... Installation of a user directory . ... Below, we use the following notations: XXXX - CompHEP version number; comphep-XXXX - directory where CompHEP files will live; comphep-XXXX.tgz - distributive tar-file with sources; comphep-XXXX-linux.tgz - distributive tar-file with binaries; . ... The directory with name comphep-XXXX will be created with all files of CompHEP distributive. ... In order to create a user working directory execute: make setup WDIR=path_to_user_work_directory . ...

Еще в разделе: (Показать все результаты (>24) - comphep.sinp.msu.ru/ )

• new-mac [CompHEP]
• extra:main [CompHEP]

... Parent Directory - 1-1-GeneralTopology-Conspectus-2009.pdf 26-Aug-2009 19:49 189K 1-1-GeneralTopology-Conspectus-Addendum-5-5-2009.pdf 09-Sep-2009 12:56 131K 1-4-Examples-Addendum.pdf 22-Sep-2009 11:50 89K Alexandrov-168-169.pdf 08-Sep-2009 12:36 225K ControlWorks/ 05-Sep-2009 15:50 - FAQ/ 08-Sep-2009 13:53 - Poincare.pdf 08-Nov-2007 15:29 296K Program-2009.pdf 16-Aug-2009 12:31 89K Test1-2009.pdf 28-Aug-2009 15:42 83K UchPr-2009.htm ...

Еще в разделе: (Показать все результаты (>281) - higeom.math.msu.su/ )

. home page . lab members . about us . foto&video . articles . links . The page is under construction

Еще в разделе: (Показать все результаты (>34) - cellmotility.genebee.msu.ru/ )

• about_us
• Cell Motility Lab

... Таня Трубичева, Коля Чеботарев, Сергей Меженный, Андрей Лебедев . ... Слева направо: Паша Зинюков, Булат Мавлюдов, Галя Ивутина (выше), Муся Григорян, Саша Игнатьев. ... Слева направо: 1)Аня Ноздрачева, 2)Дима Китаев, 3)Миша Ноздрачев, 4)Женя Цибиков, 5)Костя Фирсов, 6)Володя Трифонов, 7)Тамара Голубицкая, 8)Таня Михайлина, 9)Саша Игнатьев, 10)Валя Рябинкина, 11)Таня Чеботарева, 12)Оля Гусева, 13)Коля Чеботарев. ... Таня Гужва, Таня Немченко, Даниэль Усиков перед спуском в снежную . ...

Еще в разделе: (Показать все результаты (>11) - optics.sinp.msu.ru/ )

• polist99
• zagedan

... License . ... This program is free software: you can redistribute it and/or modify . it under the terms of the GNU General Public License as published by . the Free Software Foundation, either version 3 of the License, or . ... This program is distributed in the hope that it will be useful, . ... GNU General Public License GNU General Public License for more details. ...

Еще в разделе: (Показать все результаты (>15) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus

The Chair of Mathematical Theory of Intelligent Systems and . ... Research . ... Computer Solver . ... Computer Teacher . development of computer teaching systems . ... Demos . ... Demo program (to setup it on your computer you should copy the setup file to some directory on your hard disk and then unzip it). Presentation (in Microsoft Power Point format) . Demo program (to setup it on your computer you should copy the setup file to some directory on your hard disk and then run it). ...

Еще в разделе: (Показать все результаты (>91) - www.intsys.msu.ru/ )

• Intelligent Systems :: Research
• Installation
• Intelligent Systems :: Research :: Information Monitoring

The laboratory runs currently several scientific projects aimed at the foundations of quantum information science (the theories of quantum measurement and entanglement, design and analysis of quantum cryptographic protocols, atoms dynamics in optical dipole trap, etc.), applications of quantum theory to modeling quantum interference phenomena in multilevel atoms interacting with optical and magnetic fields (dark resonance spectroscopy), and exploring ... Physics 96 (4), 629-642 (2003). ...

Еще в разделе: (Показать все результаты (>77) - qilab.phys.msu.ru/ )

Tools for monitoring of data exchange in real-time avionics systems V.V. Balashov, V.A. Balakhanov, A.G. Bakhmurov, M.V. Chistolinov, P.E. Shestov, R.L. Smeliansky, N.V. Youshchenko Lomonosov Moscow State University, Dept. of Computational Mathematics and Cybernetics, Laboratory of Computer Systems e-mail: {hbd,baldis,bahmurov,mike,osmin,smel,yoush}@lvk.cs.msu.su Abstract In this paper we present a toolset for monitoring of data exchange through onboard channels of real-time avionics (RTA) systems. ...

Еще в разделе: (Показать все результаты (>13) - lvk.cs.msu.su/ )

• http://lvk.cs.msu.su/~sveta/4-5utils.pdf
• http://lvk.cs.msu.su/~sveta/4-2wireshark.pdf
• http://lvk.cs.msu.su/~dimawolf/ArchEVM/Lection12.pdf

... The short questionnaire below has been prepared by the Task Force for International Women in American Studies (appointed by the American Studies Association). In case you have already answered a longer questionnaire and expressed your interest in our directory, this will only ask you to confirm your facts and add a small summary of your research interests. ... Co-Chairs, ASA, Task Force for International Women . ...

Еще в разделе: (Показать все результаты (>110) - www.prof.msu.ru/ )

NGS Data Analysis with Unipro UGENE Olga Golosova, Yuriy Vaskin, German Grekhov, Yuliya Algaer UNIPRO, Lavrentieva ave. ... That is where Unipro UGENE NGS framework comes in play. ... Moreover, the UGENE toolkit allows one to automate common tasks by creating workflows with the integrated tools using the UGENE Workflow Designer. Analysis of NGS data with UGENE may start, for example, from quality control of raw NGS data, received from a sequencing facility, with the integrated FastQC [3] tool. ...

Еще в разделе: (Показать все результаты (>167) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/245.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/6.pdf

miniSTRY OF HEALTHCARE AND SOCIAL DEVELOPMENT RF NORTHERN RESEARCH CENTER NORTH-WEST BRANCH RAMS federal service for hydrometeorology and environment monitoring (rosgidromet) MINISTRY OF HEALTHCARE AND SOCIAL DEVELOPMENT OF ARKHANGELSK REGION territorial administration of federal service for consumers' rights protection Surveillance and human well-being in arkhangelsk region NORTHERN STATE MEDICAL UNIVERSITY [pic] NEWSLETTER of the All-Russian Science-and-Practice ...

Еще в разделе: (Показать все результаты (>20) - www.anthropos.msu.ru/ )

... public class ExtensionFileFilter . ... A convenience implementation of FileFilter that filters out all files except for those type extensions that it knows about. ... Extension - create a new filter that filerts out all files but gif and jpg image files: JFileChooser chooser = new JFileChooser(); ExtensionFileFilter filter = new ExtensionFileFilter( new String{"gif", "jpg"}, "JPEG GIF Images") chooser.addChoosableFileFilter(filter); chooser.showOpenDialog(this); . ... private java.lang.String . ...

Еще в разделе: (Показать все результаты (>49) - angel.cs.msu.su/ )

• Index
• : Interface NetcdfService
• Index of /~oxana

Prediction of physical properties of materials based only on their chemical composition has long been an intriguing task. ... The main interests of Prof. Lebedev 's group are physical properties of crystals exhibiting structural instability, in which different phase transitions (including the ferroelectric one) can appear. ... A.I. Lebedev. ... Physics of the Solid State 51 , 362 (2009) ; e-print arXiv:1305.0240 (2013) ; [local copy] . ... Physics of the Solid State 51 , 2324 (2009) ; [local copy] . ...

Еще в разделе: (Показать все результаты (>37) - scon155.phys.msu.su/ )

... e-mail: info@gaudeamus.cz; http://www.gaudeamus.cz | APPLICATION FORM FOR PARTICIPATION |Organizer's details | ... Exhibition website: http://www.gaudeamus.cz | ... Application deadline: 20th December 2011 |BASI|Name of school: | ... WE REQUIRE THE FOLLOWING STANDARD EXHIBITION STAND OR SPACE AND SERVICES: | ... type D|Application Form. | ... With these two items, you have the |presentation of basic information | ... With this type of presentation, you|your school at the exhibition website | ...

Еще в разделе: (Показать все результаты (>78) - phys.msu.ru/ )

• Гумбольдтовская лекция на физфаке

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

Development and Validation of Antioxidant Capacity Assessment Protocol for Humic and Humic-Like Substances Ilya Nikolaev1, Olga Klein1, Natalia Kulikova1,2, Elena Stepanova1, Olga Koroleva 1 1 A.N. Bach Institute of Biochemistry Russian Academy of Sciences, Leninskii 33, 119071,Moscow, Department of soil Science, Lomonosov Moscow State University, Leninskie Gory, 119992, Russia, ilya_mbf@yahoo.com 2 Moscow, Russia Keywords: antioxidant capacity, humic and humic-like substances 1. ...

Еще в разделе: (Показать все результаты (>106) - mgumus.chem.msu.ru/ )

... Publications . ... SPDC Laboratory . ... Security of Quantum Key Distribution Protocol Based on Ququarts?, . ... We discuss the security of QKD protocol with four-state system based on single spatial and frequency non-degenerate down converted photons. ... It has been shown that QKD protocol with four-dimensional states belonging to three mutually unbiased bases provides better security against the noise and eavesdropping than protocols exploiting two bases with qubits and ququarts. ...

Еще в разделе: (Показать все результаты (>132) - qi.phys.msu.ru/ )

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>25) - tukachev.flogiston.ru/ )

• Coursera?s Computing for Data Analysis course on R
• Category: Новости

Lab . Main page News People . ASA . Master . Master net Homepage . ... MASTER . ... About Space Monitoring Laboratory, scientific directions, instruments, contacts . People, who work in lab . Latest news and news archive . ... ведущий инженер . ... инженер . ... All news ...

Еще в разделе: (Показать все результаты (>188) - master.sai.msu.ru/ )