... Construction of generating polynomials for residue codes of degrees 5-8 . ... Feynman integrals on functionals of the exponential type with polynomial degree . ... Complexity of realization of multi-valued logics functions by formulas of special type . ... Short trigonometric sums with not integer degree of natural number . ... One-dimensional liquid flow through a porous frame under interactive loads of the Darcy type and front pressure . ... Toggle formulas format . ...

Еще в разделе: (Показать все результаты (>79) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник

Proposals and projects in the Coordinated Call FP7-ICT-2011-EU- Russia Information Meeting Moscow: 21st October, 2010 EU- Russia Call · First ICT Joint Call with Russia (dedicated INCO Call in WP 11-12); joint calls have already been implemented in other areas of FP7 · Russia is investing in High Performance Computing: No 12 supercomputer in the top500 list is Russian; aiming to enter Top3 already in ...

Еще в разделе: (Показать все результаты (>32) - www.msu.ru/ )

... It is shown that theoretical methods developed for description of hopping transport in disordered inorganic solids, such as amorphous semiconductors, can also be successfully applied to description of hopping transport in organic disordered systems, such as conjugated or molecularly doped polymers. We concentrate our discussion on percolation approach and show its universal applicability to systems with different distributions of localized state energies. ...

Еще в разделе: (Показать все результаты (>37) - scon155.phys.msu.su/ )

• Generalized pair approximation in the description of ate AC conductivity of a

... Linguistic expeditions . ... Logical and stylistic aspects of lexical semantics . ... Linguistic phenomena can be approached and described from various perspectives. ... The approach proposed here is distinctive in that it is based on logic and stylistics, which are usually considered marginal to the description of linguistic phenomena. ... A special focus in the present approach on parallel texts is directly connected with translation . ...

Еще в разделе: (Показать все результаты (>22) - lcl.srcc.msu.ru/ )

... They elected her to represent them on the committee. 4.to lose elections ­ to receive an amount of money paid by government or company, to someone who can no longer earn money by working. ... The government must introduce new tough policies to reduce unemployment. 8.to give glimpses ­ a person who travels from place to place and holds religious meetings in the open air to persuade people to become Christians. ... Most students have to stretch their money while studying away from home. ...

Еще в разделе: (Показать все результаты (>18) - www.eng.math.msu.su/ )

... A new image object format suggested. ... DataPtr ­ pointer to image data row. ... Collections.Generic; System.Windows.Forms; Microsoft.JScript; Microsoft.JScript.Vsa; Microsoft.Vsa; } return result; // Reading script from file public static string ReadScriptFromFile( string fileName) { System.IO.StreamReader sr = new System.IO.StreamReader(fileName); string sScript = ; try { sScript = sr.ReadToEnd(); } catch (Exception ex) { //TODO } finally { sr.Close(); } } return sScript ...

Еще в разделе: (Показать все результаты (>96) - imaging.cmc.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2008.cyprus.yurin.plf.en.pdf

This page is in KOI-8 encoding . 2D inversion results for the VES field data obtained near Sevastoplol (the Ukraine) with the . ... The objective of the survey was to study the lambstone massif (the right-hand part of the cross-section) embedded in the litified clays (the central and the left-hand part of the cross-section). ... According to the geological data, it is likely that the lambstone block forms the landslide body slipping over the water-saturated litified clays. ...

Еще в разделе: (Показать все результаты (>63) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

Doxyfile 1.4.6-NO # This file describes the settings to be used by the documentation system # doxygen (www.doxygen.org) for a project # # All text after a hash (#) is considered a comment and will be ignored # The format is: # TAG = value [value, .. ... USE_WINDOWS_ENCODING = YES # If the BRIEF_MEMBER_DESC tag is set to YES (the default) Doxygen will # include brief member descriptions after the members that are listed in # the file and class documentation (similar to JavaDoc). ... The default is NO. ...

Еще в разделе: (Показать все результаты (>17) - imaging.cs.msu.ru/ )

• Imaging lab: people

Title Should Be in Bold, 18-Point Type and Centered, Please Use Title Case Author name(s) [10-point type, centered, bolded] Author affiliation and full address (8-point type, centered, italicized) Author e-mail address: (8-point type, centered, italicized) Abstract: Indent left and right margins 0.5 in. (1.27 cm), justify the paragraph (on both right and left), and use the same font as in the body of the paper. ... 5] Author(s), "Title of paper," in Title of Proceedings, Name(s), ed(s)., ...

Еще в разделе: (Показать все результаты (>7) - iconolat13.phys.msu.ru/ )

... Parent Directory - 1-1-GeneralTopology-Conspectus-2009.pdf 26-Aug-2009 19:49 189K 1-1-GeneralTopology-Conspectus-Addendum-5-5-2009.pdf 09-Sep-2009 12:56 131K 1-4-Examples-Addendum.pdf 22-Sep-2009 11:50 89K Alexandrov-168-169.pdf 08-Sep-2009 12:36 225K ControlWorks/ 05-Sep-2009 15:50 - FAQ/ 08-Sep-2009 13:53 - Poincare.pdf 08-Nov-2007 15:29 296K Program-2009.pdf 16-Aug-2009 12:31 89K Test1-2009.pdf 28-Aug-2009 15:42 83K UchPr-2009.htm ...

Еще в разделе: (Показать все результаты (>284) - higeom.math.msu.su/ )

• C*-algebras: Talks

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>16) - antares.sinp.msu.ru/ )

ВМиК-Online! ... Студенты . ... Выпускники . Работа . ... Западная пивная компания приглашает на работу на должность System Network Administrator. ... Опыт работы от двух лет. ... Опыт работы с сетевым оборудованием Cisco. ... Западная пивная компания приглашает на работу на должность SAP Basis/DB2 Administrator. ... МГУ . ... Рейтинг компаний составляется на основе данных Клуба выпускников МГУ . ... 2001 2012 ВМиК Online! ... Комментарии и предложения присылайте на адрес info@cmc online.ru . ...

Еще в разделе: (Показать все результаты (>9) - www.cmc-online.ru/ )

... Студент мехмата Петр Митричев занял 3 место в финале Google Code Jam . В пятницу, 23 сентября 2005 года, в Калифорнии прошел финал олимпиады по программированию Google Code Jam , проводимой компаниями Google и TopCoder . ... Московский государственный университет представляли студенты четвертого курса мехмата Петр Митричев и Егор Куликов . ... Что же, будем надеяться, что Петр возьмет реванш 16 октября на TopCoder Open ежегодном чемпионате мира под эгидой TopCoder. ...

Еще в разделе: (Показать все результаты (>230) - www.mmonline.ru/ )

• В состязании Google Code Jam победил студент из Аргентины
• MMOnline | Форумы | Разное | Google Code Jam Announcement
• MMOnline | Новости | В состязании Google Code Jam победил студент из Аргентины

. [ Войти ] . Главная -> Фильмы -> Spooks: Code 9 . Пользователи . Демо . Деньги . Фильмы . Форум . Spooks: Code 9 . Великобритания 2008 . отметить . Сериал . Драма .

Еще в разделе: (Показать все результаты (>495) - kinfo.ru/ )

• No Code of Conduct - Фильмы - Kinfo.ru
• The Da Vinci Code - Фильмы - Kinfo.ru
• Code 46 - Фильмы - Kinfo.ru

New GCVS Version (GCVS5) FileName Explanations ----------------------------------------------------------------- ReadMe This file GCVS5 The ... ------------------------------------------------------ 1- 2 I2 --- Constell [1/88]Constellation numeric code 3- 6 I4 --- Number Star number within the constellation 7 A1 --- Component *Component identification 9- 18 A10 --- GCVS * Variable ... Field is non-blank if magMin is a magnitude or amplitude given in a system other than that indicated by magCode. ...

Еще в разделе: (Показать все результаты (>87) - sai.msu.ru/ )

• General Catalogue of Variable Stars: Vols I-III (the new electronic version).
• General Catalogue of Variable Stars: Description

... Research programm of the laboratory-chair< . ... Laboratory-chair of Discrete mechanics on a microscopic scale . ... Thus the structures of the physical world are not physical objects but physical processes. ... The primitive entity is called a material point. ... The value of the property “existence” of the material point varies from “the material point does not exist” to “the material point exists” by this process. ... Let call this structure a dynamical graph or a d-graph. ...

Еще в разделе: (Показать все результаты (>355) - chronos.msu.ru/ )

• On the Way to Understanding the Time Phenomenon: the Constructions of Time in
• M.Shulman
• Biology Direct | Full text | Erwin Schroedinger, Francis Crick and epigenetic

... Commission on Paleopedology . ... THE FIRST SCIENTIFIC DESCRIPTION OF EUROPEAN LOESS-PALEOSOL SEQUENCES - Alexander Makeev 08/3/2006 ( 0) . ... paleosol] Re: PalaeoPedology as a Commission - Dr.Stephen Nortcliff 27/11/2003 ( 0) . paleosol] Re: PalaeoPedology as a Commission - dan yaalon 26/11/2003 ( 0) . paleosol] Re: The future of the Paleopedogy Commission - Mermut 28/9/2003 ( 0) . ... Definition of paleosol and geosol; memo to John Catt - Roger Morrison 10/10/99 ( 1) . ...

Еще в разделе: (Показать все результаты (>2) - www.paleopedology.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>31) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should

... 19-Jan-2010 19:53 . ... 4.6K . ... 19K . ... 116 . ... Apache/2.2.16 (Debian) Server at www.kosmofizika.ru Port 80 ...

Еще в разделе: (Показать все результаты (>214) - www.kosmofizika.ru/ )

• Index of /sinp/panasyuk/cr18_files
• Index of /sinp/panasyuk/cr10_files
• Index of /sinp/panasyuk/cr11_files