GDE alignment format is one of standard alignment formats. A popular program for sequence alignment, Clustal, for example, can save alignment in this format. In this format, all letters indicating amino acids are in lower case, gaps are indicated by dashes. Sequences are placed one after another, name of each sequence is placed onto a separate line and begins with ‘%’. The sequence is placed afterwards beginning on the next line and may be broken into several lines. ...

Еще в разделе: (Показать все результаты (>134) - bioinf.fbb.msu.ru/ )

• SDPsite - Gallery of examples
• Alignment example
• SDPsite - Algorithm Format requirements

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>16) - antares.sinp.msu.ru/ )

New GCVS Version (GCVS5) FileName Explanations ----------------------------------------------------------------- ReadMe This file GCVS5 The ... ------------------------------------------------------ 1- 2 I2 --- Constell [1/88]Constellation numeric code 3- 6 I4 --- Number Star number within the constellation 7 A1 --- Component *Component identification 9- 18 A10 --- GCVS * Variable ... Field is non-blank if magMin is a magnitude or amplitude given in a system other than that indicated by magCode. ...

Еще в разделе: (Показать все результаты (>71) - sai.msu.ru/ )

• General Catalogue of Variable Stars: Vols I-III (the new electronic version).
• General Catalogue of Variable Stars: Description

... Research programm of the laboratory-chair< . ... Laboratory-chair of Discrete mechanics on a microscopic scale . ... Thus the structures of the physical world are not physical objects but physical processes. ... The primitive entity is called a material point. ... The value of the property “existence” of the material point varies from “the material point does not exist” to “the material point exists” by this process. ... Let call this structure a dynamical graph or a d-graph. ...

Еще в разделе: (Показать все результаты (>346) - chronos.msu.ru/ )

• On the Way to Understanding the Time Phenomenon: the Constructions of Time in
• Quantitative methods of ecological control:
• A METHOD FOR DETERMINING ECOSYSTEM NORMAL FUNCTIONING REGIONS

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... research . ... Ryabov A.B., Rudolf L., and Blasius B. (2010) Vertical distribution and composition of phytoplankton under the influence of an upper mixed layer. J. Theor. ... Phys. J. Special Topics 157: 223тАУ238 . In billiards with perturbed boundaries a billiard ball will change its velocity, which is know as Fermi acceleration. ... Loskutov A., Chichigina O., and Ryabov A. (2008) Thermodynamics of dispersing billiards with time-dependent boundaries. ... й2009 Ryabov Alexey | ...

Еще в разделе: (Показать все результаты (>113) - chaos.phys.msu.ru/ )

• Vertical phytoplankton profiles

... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...

Еще в разделе: (Показать все результаты (>4) - oc.cs.msu.ru/ )

... A minimal extension of the SM mD The see-saw orthogonal matrix "Vanilla" Leptogenesis (Fukugita,Yanagida '86) Let us start 1) Flavor from the effects simplest scenario (,,vanilla" leptogenesis) are neglected Total CP asymmetries If i 0 a lepton asymmetry is generated from Ni decays and partly converted into a baryon asymmetry by sphaleron processes if Treh t 100 GeV ! ... Main lessons from vanilla leptogenesis 2) Neutrino mass bounds ...but not too strong to prevent successful leptogenesis ! ...

Еще в разделе: (Показать все результаты (>130) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/220809/Demidov.pdf

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>44) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should
• Gol'dman N. L. Properties of solutions of parabolic equations with unknown

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>17) - observ.pereplet.ru/ )

... 19-Jan-2010 19:52 . ... 10K . ... 18K . ... 19K . ... 16K . ... 116 . ...

Еще в разделе: (Показать все результаты (>213) - www.kosmofizika.ru/ )

• Index of /sinp/panasyuk/cr18_files
• Index of /sinp/panasyuk/cr08_files
• Index of /sinp/panasyuk/cr10_files

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>170) - tukachev.flogiston.ru/ )

• Category: Новости

... Микс 193 A 131 A 171 A 211 A 304 A Корона Магнитограмма . 211 + 193 + 171 . Description . ... LASCO (Large Angle and Spectrometric Coronagraph)- инструмент на космическом аппарате SOHO, поставляющий изображения солнечной короны, на которых свет, идущий непосредственно от Солнца, заблокирован с помощью искусственного затмения, создаваемого самим аппаратом. ... The form and the location of the magnetospheric boundary are defined by pressure balance of the solar wind and geomagnetic field. ...

Еще в разделе: (Показать все результаты (>1228) - swx.sinp.msu.ru/ )

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

75. Abstract

76. http://www.geogr.msu.ru/structure/labs/geos/personal/belova/Belova_2013_Pushchino.pdf

77. XAFS Publication Database search form

78. MSU Science Park - Venue & Space

79. http://www.psy.msu.ru/science/conference/khomskaya/2014/musalek.pdf

80. Moscow University Chemistry Bulletin Vol. 48, No. 4, P. 235 (2007)