... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>98) - vestnik.math.msu.su/ )

... N ( ) K ( ) = 2k BT s i =1 N i exp(- / ) * i i =1 N i = 1 i - i- ?? N . ... K ( ) = 2k BT S 1 exp (- ) + 2 exp (- ) 1 2 DMA: 1 = 2.6 ps;1 = 0.17 2 = 0.44 ps; 2 = 0.83 N-afes N (q1, ... qN): U i (q1 , ..., qN ) = N j =1 j 2 jq j U f (q1 , ..., qN ) = N j =1 j j (q j - 1) + I pers, exp 2 S2O822 2 - -EG S2O8 - + e = SO4 - + SO4 : current vs EG content 12 8 4 0 0 20 I /A potentials (V) vs SCE - 0.6 -0.7 - 0.8 -0.9 -1.0 -1.1 40 60 80 delta x(EG), mol % 3 2 1 0.8 0.6 0.4 0.2 ...

Еще в разделе: (Показать все результаты (>57) - electr003.chem.msu.ru/ )

... Форумы > Первокурсникам > Тема . Автор темы Web Surfer . Форумы Список тем Новая тема . ... Web Surfer . ... Решение сравнений над полем: x^n==b(mod m) . Каким образом можно решить сравнение вида: x^n==b(mod m)? ... Следующая тема Предыдущая тема . ... Извините, только зарегистрированные пользователи могут публиковать сообщения в этом форуме. ... Сайт работает с 29.08.2000, Copyright 2000 2011 MMOnline.Ru and MMForce.Net, . ...

Еще в разделе: (Показать все результаты (>196) - www.mmonline.ru/ )

• MMOnline | Форумы | Первокурсникам

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Online . ... More than 40 000 students (graduate and postgraduate) and about 7 000 undergraduates study at the university, and over 5 000 specialists do the refresher course here. ... Moscow University campus is an extremely complex system, with its 1 000 000 m2 floor area in 1 000 buildings and structures, with its 8 dormitories housing over 12 000 students and 300 km of utility lines. ...

Еще в разделе: (Показать все результаты (>29) - www.msu.ru/ )

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ... As colored columns of the alignment. ...

Еще в разделе: (Показать все результаты (>4351) - monkey.belozersky.msu.ru/ )

• SDP home page
• Inquiry information || Parsimony algorithm
• SCOP famyli:

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>19) - comphep.sinp.msu.ru/ )

• extra:model:main [CompHEP]

... DESCRIPTION General Catalog of Variable Stars (GCVS database) . ... Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1990, General Catalogue of Variable Stars, 4rd ed., vol.IV, Nauka, Moscow. Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1992, General Catalogue of Variable Stars, 4rd ed., vol.IV, Bull. ... Kazarovets E.V., Durlevich O.V. Editor-in-Chief Samus N.N., 1998, New Catalogue of Suspected Variable Stars. ...

Еще в разделе: (Показать все результаты (>74) - sai.msu.ru/ )

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>55) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should
• Savostyanov D.V., Tyrtyshnikov E.E., Zamarashkin N.L. Fast truncation of mode

... L Сd , Pol a nd ABOUT EFFECTIVE MODES METHOD FOR DESCRIPTION OF INTERNAL DYNAMICS OF WEAKLY BOUND CLUSTERS Elena Belega, Evgeny Cheremukhin 1 , Dmitry Trubnikov Abstract: New approach to describe the internal dynamics of weakly bound clusters is presented. ... It is found that the number of active collective modes depends on the initial cluster excitation and that the internal energy is partitioned nonuniformly among the modes. ... Collective motion of oxygen atoms performs mostly in plane. ...

Еще в разделе: (Показать все результаты (>21) - beams.chem.msu.ru/ )

• http://beams.chem.msu.ru/doc/JCPSA613314144101_1.pdf

... 19-Jan-2010 19:53 . ... 4.6K . ... 19K . ... 116 . ... Apache/2.2.16 (Debian) Server at www.kosmofizika.ru Port 80 ...

Еще в разделе: (Показать все результаты (>227) - www.kosmofizika.ru/ )

• Index of /sinp/panasyuk/cr18_files
• Index of /sinp/panasyuk/cr10_files
• Index of /sinp/panasyuk/cr11_files

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

73. FDSL-7.5 | Home

74. Guidelines

75. Statistics One, Lecture 3, example script

76. SWX - Космическая погода

77. culmination fashion of in defiance of a mode ugg boots on purchasing like on

78. Our publications

79. SPAW Editor documentation

80. Олимпиада школьников ?Ломоносов?