... 2013-03-19 02:34 . ... index.htm . ... 1.1M . ...

Еще в разделе: (Показать все результаты (>394) - herba.msu.ru/ )

• Systema Naturae
• Index of /shipunov/school/biol_154/textbook/pics
• Materials of A. Shipunov

... Parent Directory - 1-1-GeneralTopology-Conspectus-2009.pdf 26-Aug-2009 19:49 189K 1-1-GeneralTopology-Conspectus-Addendum-5-5-2009.pdf 09-Sep-2009 12:56 131K 1-4-Examples-Addendum.pdf 22-Sep-2009 11:50 89K Alexandrov-168-169.pdf 08-Sep-2009 12:36 225K ControlWorks/ 05-Sep-2009 15:50 - FAQ/ 08-Sep-2009 13:53 - Poincare.pdf 08-Nov-2007 15:29 296K Program-2009.pdf 16-Aug-2009 12:31 89K Test1-2009.pdf 28-Aug-2009 15:42 83K UchPr-2009.htm ...

Еще в разделе: (Показать все результаты (>294) - higeom.math.msu.su/ )

... Kornev, V., Sharafiev, A., Kolotinskiy, N., and Mukhanov, O. Microwave dynamics of superconducting quantum cell.љ ... DOI љ] . ... Kornev, V., Sharafiev, A., Soloviev, I., and Mukhanov, O. Signal and noise characteristics of bi-squid.љ ... Kornev, V., Sharafiev, A., Soloviev, I., Kolotinskiy, N., Skripka, V., and Mukhanov, O. Superconducting quantum arrays.љ ... Kornev, V., Sharafiev, A., Soloviev, I., Kolotinskiy, N., and Mukhanov, O. Superconducting quantum arrays for broadband rf systems.љ ...

Еще в разделе: (Показать все результаты (>10) - cryolab.phys.msu.ru/ )

• Publications (from 2011)
• Victor K. Kornev

akishin@hep.sinp.msu.ru The arcing causes degradation of solar array at malfunction of instruments on satellites. The discharge is caused by differential potential between satellite body and insulator surfaces like coverglass of solar arrays, whitch are charged by ambient plasma. ... 0.01 ­ 1 [1-3]. U=100 . ... p =1 , 400. ... 2004 . ... Development of 400V. Solar Array Technology for Low Earth Orbit Plasma Environment. ... Stretched Lens Array (SLA), A Reliable Solar Array for Any Orbit. ...

Еще в разделе: (Показать все результаты (>194) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/210809/Pravdin.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/220809/Demidov.pdf

On problem of interpretation and forecasting space-temporary variations of geophysical fields on results of deep scientific drilling Esipko O.A., Kolbasova A.V., Rosaev A.E. In the process of boring the deep bore holes, as scientific, so and industrial one's living, and when processing the received results, the problem of large arrays of data analyses appears. ... The example of geophysical data development As an example of with depth and variation log data with 0.2 meters of (verified) data. ...

Еще в разделе: (Показать все результаты (>62) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/kiseleva/acat2_kiseleva.pdf
• http://acat02.sinp.msu.ru/poster-sessions.html
• http://acat02.sinp.msu.ru/24june.html

... Research programm of the laboratory-chair< . ... Laboratory-chair of Discrete mechanics on a microscopic scale . ... Thus the structures of the physical world are not physical objects but physical processes. ... The primitive entity is called a material point. ... The value of the property “existence” of the material point varies from “the material point does not exist” to “the material point exists” by this process. ... Let call this structure a dynamical graph or a d-graph. ...

Еще в разделе: (Показать все результаты (>411) - chronos.msu.ru/ )

• On the Way to Understanding the Time Phenomenon: the Constructions of Time in
• Determination analysis as a method for diagnostics of ecosystem condition

... Recommended values . Start word length . Start length of motiff for Multiple sequence alignment. ... Max N Mismatches . ... Min score . ... Gap parameter . This parameter defines gap scoring. the grater this value is the stronger gap will be panalysed . ... If inforation content of a column is less than given value the column should be not included into alignment. the grater this value is the stronger gap will be panalysed . ... Max loop . Max energy of a helix . ... cgcatagctc cacca . ...

Еще в разделе: (Показать все результаты (>139) - bioinf.fbb.msu.ru/ )

• SDPsite - Gallery of examples
• Alignment example
• Algorithm

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ... As colored columns of the alignment. ...

Еще в разделе: (Показать все результаты (>295) - monkey.belozersky.msu.ru/ )

• SDP home page
• Inquiry information || Parsimony algorithm
• SCOP famyli:

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>70) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should
• S. Piskarev. Shadowing in approximations of abstract parabolic equations //

... DESCRIPTION General Catalog of Variable Stars (GCVS database) . ... Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1990, General Catalogue of Variable Stars, 4rd ed., vol.IV, Nauka, Moscow. Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1992, General Catalogue of Variable Stars, 4rd ed., vol.IV, Bull. ... Kazarovets E.V., Durlevich O.V. Editor-in-Chief Samus N.N., 1998, New Catalogue of Suspected Variable Stars. ...

Еще в разделе: (Показать все результаты (>83) - sai.msu.ru/ )

• General Catalogue of Variable Stars: Vols I-III (the new electronic version).

ASA) (ASA) 20 c . ... 800 , ASA . ... Acoustic tomography with nonuniformly sparsed ring antenna array The main goal is to study: the quality of ultrasound fields generated by therapeutic multi-element arrays when the focus is steered electronically; nonlinear propagation effects in heating of soft tissue in the presence of ribs using therapeutic arrays. ...

Еще в разделе: (Показать все результаты (>41) - acoustics.phys.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

. Name . Last modified . Size . Description . Parent Directory . - . next.gif . 19-Jan-2010 19:54 . 116 . prev.gif . 19-Jan-2010 19:54 . 116 . rtop.gif . 19-Jan-2010 19:54 . 896 . Apache/2.2.16 (Debian) Server at www.kosmofizika.ru Port 80

Еще в разделе: (Показать все результаты (>375) - www.kosmofizika.ru/ )

• Index of /sinp/panasyuk/cr18_files
• Index of /sinp/panasyuk/cr11_files
• Index of /sinp/panasyuk/cr13_files

Faculty of Physics, Lomonosov Moscow State University Advanced Quantum Field Theory: Modern Applications in HEP, Astro & Cond-Mat Instructor: assist. prof., Dr. Oleg Kharlanov Term 2 Examination Syllabus (Fall 2014) 1. ... Self-consistent field approximation: the Hartree­Fock and Hartree­Fock­Roothaan equations; a qualitative analysis of the approximations used. ... Fundamentals of the Density functional theory: the energy functional, the Hohenberg­Kohn theorems, the universal functional F[n(x)] . ...

Еще в разделе: (Показать все результаты (>5) - theorphys.phys.msu.ru/ )

... Recently we described a novel method for forming substrate-supported macroscopically-aligned lipid bilayers by self-assembling phospholipids into nanotubular structures inside ordered nanochannels of anodic aluminum oxide (AAO) [1]. We have also shown that these nanotubular bilayers retain many properties of unsupported bilayers and are suitable for incorporating transmembrane peptides and small membrane proteins [2]. ... 2007 Biophysics dep., ...

Еще в разделе: (Показать все результаты (>28) - www.msm.biophys.msu.ru/ )

... Микс 193 A 131 A 171 A 211 A 304 A Корона Магнитограмма . 211 + 193 + 171 . Description . ... LASCO (Large Angle and Spectrometric Coronagraph)- инструмент на космическом аппарате SOHO, поставляющий изображения солнечной короны, на которых свет, идущий непосредственно от Солнца, заблокирован с помощью искусственного затмения, создаваемого самим аппаратом. ... The form and the location of the magnetospheric boundary are defined by pressure balance of the solar wind and geomagnetic field. ...

Еще в разделе: (Показать все результаты (>1236) - swx.sinp.msu.ru/ )

Download FDSL 7.5 flyer ! home . ... The 7.5th European Conference on Formal Description of Slavic Languages, Moscow, December 6 8, 2008 . The European Conference on Formal Description of Slavic Languages was first held in 1995 at the University of Leipzig. Up till 2006, the biannual FDSL was hosted in turn by the University of Leipzig and Potsdam University. ... December 6 8, 2008 . ... FDSL 7.5 (halftime) will be held on December 6 8, 2008 at the Independent University of Moscow. ...

Еще в разделе: (Показать все результаты (>274) - www.philol.msu.ru/ )

• FDSL-7.5 | Call for Papers
• LangueDOC :: Archi :: Alphabet

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>12) - tukachev.flogiston.ru/ )

• Category: Новости

... Начало www.99ru.ru Книги о РУСИ Славянская традиция 8265 . ... Искусство . История.Философия . ... Художественные . ... История Всемирная . ... Искусство и культура . ... Другие виды искусства . ... Этнография Фольклор . ... Наследие Востока . ... Введите код товара из каталога. автор Велецкая Н.Н. Символы славянского язычества. руб. ... Велецкая Н.Н. Символы славянского язычества. ... Автор этой книги, отечественный славист с мировым именем - Наталья Николаевна Велецкая, делает такую попытку. ...

Еще в разделе: (Показать все результаты (>17) - www.bukivedi.ru/ )

Diploma thesis abstract Combined optoacoustic and laser ultrasonic tomography of biological tissues Bychkov A.S. Academic adviser: Prof. Dr. Karabutov A.A. This diploma thesis contains 61 pages, 28 illustrations, 1 table, 37 references, 2 appendices. ... Mathematical modelling of sensitivity maps of phased arrays with various geometries was conducted. ... Experiments on modelling of needle insertion into blood vessel model and comparison of calculated and experimental data were conducted. ...

Еще в разделе: (Показать все результаты (>47) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2008/Simonova_Karabutov_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2015/Lipatov_Magnitskiy_en.pdf