... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>71) - vestnik.math.msu.su/ )

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>12) - antares.sinp.msu.ru/ )

... 2013-03-19 02:34 . ... index.htm . ... 1.1M . ...

Еще в разделе: (Показать все результаты (>394) - herba.msu.ru/ )

• Systema Naturae
• Index of /shipunov/school/biol_154/textbook/pics
• Materials of A. Shipunov

... Parent Directory - 1-1-GeneralTopology-Conspectus-2009.pdf 26-Aug-2009 19:49 189K 1-1-GeneralTopology-Conspectus-Addendum-5-5-2009.pdf 09-Sep-2009 12:56 131K 1-4-Examples-Addendum.pdf 22-Sep-2009 11:50 89K Alexandrov-168-169.pdf 08-Sep-2009 12:36 225K ControlWorks/ 05-Sep-2009 15:50 - FAQ/ 08-Sep-2009 13:53 - Poincare.pdf 08-Nov-2007 15:29 296K Program-2009.pdf 16-Aug-2009 12:31 89K Test1-2009.pdf 28-Aug-2009 15:42 83K UchPr-2009.htm ...

Еще в разделе: (Показать все результаты (>272) - higeom.math.msu.su/ )

Application of the Quickhull algorithm's principles to the double description method" . Bastrakov S.I., Zolotykh N.Yu. The double description method known also as the Motzkin-Burger algorithm is a method for computing the general solution of a system of linear inequalities. ... The numerical results demonstrate a number of advantages of the proposed modification over the original double description method and (in many cases) over the Quickhull algorithm. ... PostScript (in Russian) (1.51MB) . ...

Еще в разделе: (Показать все результаты (>135) - num-meth.srcc.msu.ru/ )

• "TreeDL: a language for description of graph structures and operations on them"
• "Automatic detection and description of supercomputer network infrastructure"
• "Implementation of the Lagrangian approach to the description of gas-particle

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>102) - neptun.sai.msu.ru/ )

• Manual Page: ab - Apache HTTP Server
• Apache Tutorial: Introduction to Server Side Includes
• Apache module mod_negotiation

... Test 1, Opteron 285 (Rev. E) 2.6 GHz, CPU time, . ... 2600 . ... Test 1, Opteron 2220 SE (Rev. F) 2.8 GHz, CPU time, . ... Test 2, Opteron 285 (Rev. E) 2.6 GHz, Wall clock time, . ... Test 2, Opteron 2220 SE (Rev. F) 2.8 GHz, Wall clock time, . ... Test 5 (PC GAMESS version 7.0.3 code), Opteron 285 (Rev. E) 2.6 GHz, CPU time, . ... Test 5 (PC GAMESS version 7.0.3 code), Opteron 2220 SE (Rev. F) 2.8 GHz, CPU time, . ... Press to visit PC GAMESS' eight core systems performance comparison page . ...

Еще в разделе: (Показать все результаты (>87) - classic.chem.msu.su/ )

• Two years later: Firefly version 8.0.0 beta benchmarks on Intel Core i7 2600K
• Just kidding: PC GAMESS/Firefly v. 7.1.C benchmarks on Atom-based system
• Preliminary PC GAMESS benchmarks on Quad-core Xeon (Clovertown)-based system

... DESCRIPTION General Catalog of Variable Stars (GCVS database) . ... Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1990, General Catalogue of Variable Stars, 4rd ed., vol.IV, Nauka, Moscow. Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1992, General Catalogue of Variable Stars, 4rd ed., vol.IV, Bull. ... Kazarovets E.V., Durlevich O.V. Editor-in-Chief Samus N.N., 1998, New Catalogue of Suspected Variable Stars. ...

Еще в разделе: (Показать все результаты (>78) - sai.msu.ru/ )

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>41) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

. Name . Last modified . Size . Description . Parent Directory . - . next.gif . 19-Jan-2010 19:54 . 116 . prev.gif . 19-Jan-2010 19:54 . 116 . rtop.gif . 19-Jan-2010 19:54 . 896 . Apache/2.2.16 (Debian) Server at www.kosmofizika.ru Port 80

Еще в разделе: (Показать все результаты (>213) - www.kosmofizika.ru/ )

• Index of /sinp/panasyuk/cr18_files
• Index of /sinp/panasyuk/cr11_files
• Index of /sinp/panasyuk/cr13_files

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>13) - comphep.sinp.msu.ru/ )

• extra:model:main [CompHEP]

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . ... Amino acid residues that determine differences in protein functional specificity and account for correct recognition of interaction partners, are usually thought to correspond to those positions of a protein multiple alignment, where the distribution of amino acids is closely associated with grouping of proteins by specificity. ... As colored columns of the alignment. ...

Еще в разделе: (Показать все результаты (>265) - monkey.belozersky.msu.ru/ )

• Inquiry information || Parsimony algorithm
• SDP home page
• SCOP famyli:

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>170) - tukachev.flogiston.ru/ )

• Category: Новости

... Микс 193 A 131 A 171 A 211 A 304 A Корона Магнитограмма . 211 + 193 + 171 . Description . ... LASCO (Large Angle and Spectrometric Coronagraph)- инструмент на космическом аппарате SOHO, поставляющий изображения солнечной короны, на которых свет, идущий непосредственно от Солнца, заблокирован с помощью искусственного затмения, создаваемого самим аппаратом. ... The form and the location of the magnetospheric boundary are defined by pressure balance of the solar wind and geomagnetic field. ...

Еще в разделе: (Показать все результаты (>1232) - swx.sinp.msu.ru/ )

• SWX - Главная

Download FDSL 7.5 flyer ! home . ... The 7.5th European Conference on Formal Description of Slavic Languages, Moscow, December 6 8, 2008 . The European Conference on Formal Description of Slavic Languages was first held in 1995 at the University of Leipzig. Up till 2006, the biannual FDSL was hosted in turn by the University of Leipzig and Potsdam University. ... December 6 8, 2008 . ... FDSL 7.5 (halftime) will be held on December 6 8, 2008 at the Independent University of Moscow. ...

Еще в разделе: (Показать все результаты (>332) - www.philol.msu.ru/ )

• Центр СМИ филологического факультета МГУ
• FDSL-7.5 | Call for Papers
• LangueDOC :: Archi :: Alphabet

... Fast Facts about the Faculty of Journalism . ... Academic Departments . ... Partners . ... All partners . ... Russian Mass Media and Journalism in global context . ... Freelance TV journalism in Russia . Independent Journalism in Russia . ... Journalism Standards and Values in Russia The course includes a practical module of newspaper and TV production . ... Faculty of Journalism . ... 1999-2014 Faculty of Journalism, Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>21) - www.journ.msu.ru/ )

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>53) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

MSU . Science Park . ... Venue & Space . ... At Moscow State University Science Park, the laboratory and administrative offices are available to hire by innovative companies on a long or short term basis. ... MSU Science Park is situated in a picturesque area of Moscow, close to the MSU Botanical Garden on Sparrow Hills. With eight, two-storey buildings of 500 m 2 each on the site plus a four-storey building with an area of 7,500 m 2 , there is a total building area of 11,500 m 2 . ...

Еще в разделе: (Показать все результаты (>8) - www.sciencepark.ru/ )

• MSU Science Park - About us

... The largest Russian and foreign companies and firms are active in cooperation with the faculty widely using a huge potential of its graduates, research and technical developments, optimizing various technological processes and solving their individual scientific and technological problems in creating new products and technologies. Nowadays Faculty of Chemistry concentrate on: . ... creation and studying of new resource and energy saving chemical, technological and biotechnological processes; . ...

Еще в разделе: (Показать все результаты (>675) - chem.msu.ru/ )

• Exciplexes on INTERNET
• Moscow University Chemistry Bulletin Vol. 49, No. 4 (2008)
• Moscow University Chemistry Bulletin Vol. 50, No. 4, P. 238 (2009)