Антонов А.С. Параллельное программирование с использованием технологии MPI: Учебное пособие. М.: Изд-во МГУ, 2004.-71с. Антонов А.С. Практический курс MPI. ... М.: Изд-во МГУ, 1991.-345с. Воеводин В.В. Параллельные структуры алгоритмов и программ. ... J. Choi, J. Dongarra, and D. Walker, PB-BLAS: A Set of Parallel Block Basic Linear Algebra Subroutines, Practice and Experience, 8 (1996), pp. 517-535. http://www.netlib.org/scalapack/html/pblas_qref.html/. ...

Еще в разделе: (Показать все результаты (>46) - num-anal.srcc.msu.ru/ )

• БЧА НИВЦ МГУ. SF62R. Интегральные и связанные с ними функции
• БЧА НИВЦ МГУ. SF62R_P. Интегральные и связанные с ними функции

... Nonlinear Ion Acoustic Waves in a Magnetic Plasma . ... These waves are described   by well known and sufficiently complicated nonlinear system of the three equations for the three desired function - the ions flow velocity, the electron (ion) density and the electrical field potential. ... As a result we find for all three desired functions quasi-monochromatic wave motions with a   general phase. In the frame of these motions explicit approximate formulae for all desired functions are constructed. ...

Еще в разделе: (Показать все результаты (>59) - acs366.phys.msu.su/ )

... id #527 . Journal of Biological Standardization [not defined] . Common information . ... no information] . ... since 1900-01-01 till today . ... http://www.sciencedirect.com/science/.. ... 1973-01-01 . 1989-12-31 . ...

Еще в разделе: (Показать все результаты (>12) - journals.genebee.msu.ru/ )

... Expanding and Retaining Customer Loyalty with Stefan Legner of InterNetX . Legner started with a brief history of InterNetX, a Regensburg, Germany based hosting and domain registrar provider that has more than 19,500 customers worldwide.He emphasized the need for companies to build long term partnerships, adding that business has always been about the relationship between people rather than companies .Where possible, Legner said that companies should provide an ... cheap the north face . ...

Еще в разделе: (Показать все результаты (>61) - elana.sinp.msu.ru/ )

• cheap ray bans uk as well as two kinds of noctilionid bats | С Днем Победы!
• contemplating working through on line wholesale directory like Salehoo to
• I?m much more into talking than listening | С Днем Победы!

... This applet generates an observing list based on an observer's location and time. ... To use this program, enter in your location, and the local times at which you wish to begin and end observing. The date you enter should correspond to the calendar day at the time at which you begin observing. For example, if you wish to observe from 9:37 PM October 23, 2007 until 3:21 AM October 24, 2007, you would enter 21:37 for the starting time, 03:21 for the finish time, and 10/23/2007 for the date. ...

Еще в разделе: (Показать все результаты (>219) - observ.pereplet.ru/ )

• MASTER GLOBAL ROBOTIC TELESCOPES NET

... Магистерское образование . ... Магистерские программы . ... Магистерские программы (учебные планы) . ... Introduction to Cryptography . ... Basic requirements for data security in software systems. ... Lecturer: associate professor Primenko E. A. Mathematical Theory of Information . ... Addition operation of elliptic curve's points. f Postnikov's theorem.Theorems on the order of elliptic curve for certain types of primes. ... Магистратура: master@cmc.msu.ru, 3-й этаж, комната 360, тел. ...

Еще в разделе: (Показать все результаты (>12) - hcs.cmc.msu.ru/ )

• Master program "Software for Computer Networks" | Магистерское и послевузовское
• The core courses for the specialty "Information Technologies" | Магистерское и
• Master program "Open Information Systems" | Магистерское и послевузовское

... Data . ... Solar energetic particles . ... Solar flare database (RU) . ... Select the storm date: . Select storm intensity threshold: . ... Developed in 2007. Copyright €й 2007 - 2016 Skobeltsyn Institute of Nuclear Physics Moscow State University Feedback ...

Еще в разделе: (Показать все результаты (>21) - smdc.sinp.msu.ru/ )

• OMNIweb mirror - Space monitoring data center
• AP8/AE8 model - Space monitoring data center
• ShielDose2 model - Space monitoring data center

... Таня Трубичева, Коля Чеботарев, Сергей Меженный, Андрей Лебедев . ... Слева направо: Паша Зинюков, Булат Мавлюдов, Галя Ивутина (выше), Муся Григорян, Саша Игнатьев. ... Слева направо: 1)Аня Ноздрачева, 2)Дима Китаев, 3)Миша Ноздрачев, 4)Женя Цибиков, 5)Костя Фирсов, 6)Володя Трифонов, 7)Тамара Голубицкая, 8)Таня Михайлина, 9)Саша Игнатьев, 10)Валя Рябинкина, 11)Таня Чеботарева, 12)Оля Гусева, 13)Коля Чеботарев. ... Таня Гужва, Таня Немченко, Даниэль Усиков перед спуском в снежную . ...

Еще в разделе: (Показать все результаты (>9) - optics.sinp.msu.ru/ )

• polist99
• zagedan

Analysis of the ANTARES data for SN neutrino detection V. Kulikovskiy (MSU / INFN Genova) Hit counts in the detector. The number of hits ( hit counts ) in a time slice (104.8 ms) is used (this information is stored in each run) Mean number of hit counts in one PMT is ~5500 (corresponds to ~55 kHz) Expected number of hits from SN in 100ms is 11.6 ( 550 0) Bioluminescence bursts should be excluded Bioluminescence cut We have collected distributions of hit counts for each ...

Еще в разделе: (Показать все результаты (>13) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/acceptance_bamberg2011-1.pdf
• http://antares.sinp.msu.ru/docs/INFN%20-%20ANTARES.pdf
• http://antares.sinp.msu.ru/docs/NIMA.pdf

... CpAppro . ... TernAPI program . ... Home Our Developments CpAppro . ... The above equation is a linear combination of thermodynamic functions of the harmonic oscillator (Planck-Einstein functions). This approach is developed as a part of a universal method of approximating temperature dependences of standard thermodynamic properties for crystalline substances. ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>7) - td.chem.msu.ru/ )

... Thus, the development of a method of synthesis of signals of finite duration, optimal in the sense of maximum concentration of energy in specified frequency ranges, is the actual problem. ... Erik Larsen, Ronald M. Aarts, "Audio Bandwidth Extension: Application of Psychoacoustics, Signal Processing and Loudspeaker Design", John Wiley & Sons, ISBN: 0-470-85864-8, September 2004. ... Time-frequency decomposition, 2. ... Shaping of the energy spectrum envelope of high-frequency content, 4. ...

Еще в разделе: (Показать все результаты (>53) - imaging.cmc.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2015.OGRW.Krylov_Nasonova_Nasonov.Warping.en.pdf
• http://imaging.cs.msu.ru/pub/2014.ICSP.Krylov_Nasonov.Warping1D.en.pdf
• http://imaging.cs.msu.ru/pub/2011.ITSF.Krylov_Mizotin.Laguerre.en.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

... Most of us spend a good part of our lives working in organizations, either as employees or managers, or both.љ The chief purpose of this courseљљ is to provide you with theoretical insights, practical skills, and ethical standards of the discipline of management with a focus on information management and human resources.љ The course is focused on people in organizations and their interactions.љ ... Администратор : Mira Bergelson . Преподаватель: Mira Bergelson . ...

Еще в разделе: (Показать все результаты (>10563) - moodle.ffl.msu.ru/ )

Diploma thesis abstract «Effect of doping on parameters of organic solar cells» student Trukhanov Vasiliy Andreevich. ... For optimized bulk heterojunction cell based on the most studied materials (blend of poly-3-hexylthiophene and fullerene derivative PCBM) it was discovered that efficiency decreases from 4.5% to 1% with increase of dopant concentration up to 1024 m-3 owing to decrease of the short-circuit current and fill factor; the open-circuit voltage changes slightly. ...

Еще в разделе: (Показать все результаты (>45) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2013/Kashtanov_Zapunidi_en.pdf
• Публикация
• Publication

... Клуб выпускников / Доска объявлений . клуб выпускников члены клуба вступить в клуб наши партнеры . Поиск работы и вакансии . ... Для участия в разработке информационных систем для гражданской авиации (Linux, C++, Oracle) с возможностью проявить себя требуются программисты C++. ... приветствуется знакомство с Unix/Linux, SQL, любой уровень знания английского . ... премии по результатам работы . место работы - рядом с м. Динамо . ... URL: http://http://www.sirena2000.ru/sirena/about.html . ...

79. Page3

80. http://hbar.phys.msu.ru/hbar/pages/vyat/vyate.html