... The role of wine tax-farming system in the forming of large capitals in Russia in the 19th century, . ... The article is devoted to one of the most profitable business activities in Russia at the end of the 18th century to the beginning of the 1860s. The author researches the social and national structure of wine tax-farmers, the level of their incomes as well as the ways and methods of accumulation of capital, in particular, their ties with the aristocracy and state officials of all levels. ...

Еще в разделе: (Показать все результаты (>3261) - hist.msu.ru/ )

• Visual Images of Patriarch Nikon

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>795) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~ramil.mintaev/projects/files/delta_aligned.fasta

... This paper argues that a mixed system of private and state universities seems the best structure to secure dynamism, accessability, and efficiency of higher education insitutions in post-industrial societies. ... Whereas the university system of Germany is to a large degree state-operated, the British system combines some elements of private higher education with an also largely state-operated university system. ... The United States would seem to provide the best structure for a university system. ...

Еще в разделе: (Показать все результаты (>131) - www.prof.msu.ru/ )

• One effective method to turn passive students into active learners in Russian
• Conferences & Publications
• February round of 2005 Alumni Small Grants Competition

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

65. Department of Algorithmic Languages

66. The Ecological Cooperation project is the first large scale childrenтАЩs

67. Publications of V.Zakharov

68. Sun

69. Лаборатория Физико-химической газодинамики

70. SAI Space Monitoring Laboratory

71. Quantum Information Lab, Int'l Laser Ctr. and Faculty of Physics, M.V.Lomonosov

72. Current Projects

73. Frolov Aleksandr Yurievich | Laboratory of Nanophotonics & Metamaterials

74. Lomonosov Moscow State University

75. Vladimir V. Busarev

76. CDFE - Centre for Photonuclear Experiments Data - Home page

77. Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник

78. Department of General Physics and magneto-ordered matter. Physics Department of

79. File Descriptor Limits - Apache HTTP Server

80. Large-Scale Load Stabilization