University Satellites and . Space Science Education . General information Date and Location Objectives of the meeting Sponsoring Organizations International Advisory Committee Local Organizing Committee Deadlines Addresses Hotels & Accommodation Venue Visas Social Programme . First circular . Second circular . ... Abstract Submission List of submitted abstracts . ... The list of abstracts submited . Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>6703) - cosmos.msu.ru/ )

... Mikhailov E.A. and Modyaev I.I. A problem connected with magnetic fields of galaxies is considered. ... These phenomena are characterized by dimensionless coefficients of the dynamo equations. ... The growth rates of statistical moments of the magnetic field are evaluated. ... The problem that has only a time dependence and the problem that has a spatial dependence are also considered. ... Keywords: galaxy magnetic fields, equations with random coefficients, dynamo theory, intermittency. ...

Еще в разделе: (Показать все результаты (>125) - num-meth.srcc.msu.ru/ )

• "Simulation of planet formation in circumstellar disks"
• "Fault tolerance of small-world regular and stochastic interconnection...
• "A small-mode approximation in the stellar dynamo problem"

... Solar Data: f.e. X-ray . Night Sky Live . ... Heavens-Above: Sky chart, Satellites, Iridiums and astronomical objects For Moscow For SAO Baksan . ... ESO-MIDAS page . ... Tutorials for Astronomy . ... Asteroid and Comet Hazard . ... Observable Comets: This page lists links to orbital elements and ephemerides of (potentially) observable comets. ... Leonid page - a lot of information for years Comets and Meteor Showers . The American Meteor Society . ... North American Meteor Network Home Page . ...

Еще в разделе: (Показать все результаты (>11) - astrometric.sai.msu.ru/ )

sp|P69618|SHDAG_HDV83 Small delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFP sp|P25989|SHDAG_HDVAM Small delta ...

Еще в разделе: (Показать все результаты (>1629) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~a_anisenko/term2/text/delta_aligned.fasta
• http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/deltaaligned.fasta

... Projectile proton energies are above 300 keV Scattering angles are of fractions of mrad . ... C.D. Lin) FBA Exact representation of the amplitude so called paraxial approximation for fast proton Exact representation of the amplitude Basis for SBA and EWBA Integral representation of EWBA (eikonal) Integral representation of the FBA CALCULATIONS: Charge transfer Hong-Keun Kim et al Phys . Rev. A 85, 022707 (2012) Powerful note All helium wave functions, both ... Phys. Rev. A 71 (2005), 12706. ...

Еще в разделе: (Показать все результаты (>14) - lmmqsp.sinp.msu.ru/ )

... Consider the Virtual Brewery, a small company that brews, as the name indicates, virtual beer. To manage their business more efficiently, the virtual brewers want to network their computers, which all happen to be PCs running a bright and shiny 1.0. ... They run an Ethernet of their own. Quite naturally, the two companies want to link their networks once they are operational. As a first step, they want to set up a gateway host that forwards datagrams between the two subnets. ...

Еще в разделе: (Показать все результаты (>172) - itpm.msu.su/ )

• Subnetworks
• Mixing UUCP and RFC-822
• The root filesystem

news ]] . ... Highlight news: CompHEP is in the top rating list on The OpenScience Project . ... 16/03/2009 New official version of CompHEP (4.5.1) is available. ... 14/11/2006 Two new versions of CompHEP-PYTHIA interface (cpyth-1.2.7 and cpyth-2.0.4) are available. ... 13/09/2006 A new version of CompHEP-PYTHIA interface and a new interface CompHEP-HERWIG has been released. ... 01/07/2006 Talk on new physics with CompHEP by M.Dubinin at Tools for SUSY and the New Physics (LAPP, 26-28 June 2006). ...

Еще в разделе: (Показать все результаты (>14) - comphep.sinp.msu.ru/ )

... Catalog . Publications . ... Koposov, S., Glushkova, E., Zolotukhin, I. 2008: Automated search for Galactic star clusters in large multiband surveys. ... BibTeX entry ] . ... Glushkova, E.V., Zabolotskikh, M.V., Koposov, S.E., Spiridonova, O.I, Vlasyuk, V.V., Rastorguev, A. S. 2010: Photometry of the poorly studied galactic open star clusters King 13, King 18, King 19, King 20, NGC 136, and NGC 7245 , Astronomy Letters, 36, 75 . ...

Еще в разделе: (Показать все результаты (>222) - ocl.sai.msu.ru/ )

• SAI OCL Catalog Virtual Observatory

... 20.09.2009 . ... Moscow Vyatichi, November 9 - 11, 2009. ... In this work we study sum-frequency generation from the surface of an isotropic chiral medium in arbitrary interaction geometry of the paraxial light beams at fundamental frequencies. ... Within the first-order approximation approach, generally, the polarization state of light is distributed inhomogeneously in the reflected signal beam cross section, and the transversal intensity distribution is not Gaussian. ... Full publication text . ...

Еще в разделе: (Показать все результаты (>178) - ofvp.phys.msu.ru/ )

... Authors: Sjoert van Velzen et al. arxiv:1511.07746 Пять новых быстрых радиовсплесков по данным обзора HTRU на высоких широтах: первые указания на двухкомпонентные всплески (Five new Fast Radio Bursts from the HTRU high latitude survey: first evidence for two-component bursts) . Authors: D. J. Champion et al. arxiv:1511.00704 Быстрорастущие транзиенты в промежутке между сверхновыми и ультрамощными сверхновыми (Rapidly Rising Transients in the Supernova - Superluminous Supernova Gap) . ...

Еще в разделе: (Показать все результаты (>526) - astro.uni-altai.ru/ )

• http://xray.sai.msu.ru/~polar/sci_rev/0609.html
• Новости науки

... тЬО labs:zotov:main ]] . THEP . ... Nikolai P. Zotov ====== {{:labs:zotov.jpg|N.Zotov}} ---- This page is under construction. ---- * [[cv|Curriculum vitae]] * Research interests ---- * List of publications (after 1991): Small x Physics * [[http://www.slac.stanford.edu/spires/find/hep/www?rawcmd=fi+a+zotov%2C+N.+P.&FORMAT=WWW&SEQUENCE=|Papers in SLAC Database]] ---- Last update: August 16, 2006\\ zotov@theory.sinp.msu.ru . labs/zotov/main.txt €§ Last modified: 27/082006 22:59 (external edit) . ...

Еще в разделе: (Показать все результаты (>2005) - theory.sinp.msu.ru/ )

• [Comphep-common] Events to produce of LHAEF format
• M.Z. Iofa Full list of publications
• SFT Inspired Cosmological Models

знания: Общая биология / Area of knowledge: Biology Наименование научного направления: Филогения и филогеография Name of since: Phylogeny and phylogeography Цель сотрудничества: Изучение систематики, филогенетики и филогеографии мелких млекопитающих Purpose of cooperation: Studies in systematics, phylogeny and phylogeography of small mammals Ссылки на публикации / Reference to publications: http :// vertebrata.bio.msu.ru / html /Bannikova_rus. html ...

Еще в разделе: (Показать все результаты (>74) - www.msu.ru/ )

• MSU Publications
• Scientific and scholarly publications in 2009
• Textbooks and handbooks publications in 2008

... 1920- . ... 1921 . ... 1925 . ... 1928 . ... 1928­1929 . 1929 . ... 1930 . ... 1933 . ... 1937 . ... 1920 1921 . ... 1929 , 1931 . ... 1934­1936 . 1932­1933. ... 28.09.1925­17.09.1926. ... 1925­1928. ... 1929­1930 . ... 1935) « » « » ( 1937). ... 1928­1970. ... 1930­1940. ... 1931­1934 .: ... 8 ­ () 1934. ... 1933­1934. ... 1934­1937. ... 1937­1962. ... 1968­1970. ... 1965­1970, 79 . ... 1925­1962 . ... 1970­1978. ... 1966­ 1970. ... 1920- 1960- . ... 1930­1970. ... 1970­1976. ... 1970. ...

Еще в разделе: (Показать все результаты (>64) - lcl.srcc.msu.ru/ )

... Small-Sowing Farms: Low-Powered or Nonoptimal? Structural analysis of social and economic processes of the Ukrainian rural area in the beginning of the New Economic Policy) . ... Ezhegodnik (Economic Hystory. ... The comparison of two types of farms discovers that even in South Ukraine where there was the greatest number of victims of the 1922 famine, small sown areas weren't caused by the low-powered economic position of farm. ...

Еще в разделе: (Показать все результаты (>166) - hist.msu.ru/ )

• CEH Publications

... О UNИX . ... Неизменяемая страница . ... Другие действия: Показать разметку Вид для печати Сформатировать как Docbook Очистить кэш страницы ------------------------ Проверить правописание Похожие страницы Карта окрестностей ------------------------ Переименовать страницу Удалить страницу ------------------------ Подписать пользователя ------------------------ Очистить от спама Вернуть эту версию Страницы пакета Синхронизировать страницы ------------------------ ...

Еще в разделе: (Показать все результаты (>82) - uneex.mithril.cs.msu.su/ )

• Index of /static/AltDocs_unix_base_admin/images
• PspoMaterials/AltDocs_install_sb - UNИX
• PspoMaterials/AltDocs_whatis_sb - UNИX

. Name . Last Modified . Size . Type . Parent Directory / . - . Directory . ChangeLog . 2016-Jan-25 19:37:22 . 2.3K . application/octet-stream . ChangeLog-2015 . 2015-Nov-09 07:11:44 . 1.7K . application/octet-stream . Manifest . 2016-Jan-25 19:37:22 . 1.8K . application/octet-stream . galaxy-2.2.ebuild . 2015-Aug-09 03:38:18 . 0.8K . text/plain . metadata.xml . 2016-Jan-25 02:06:09 . 0.4K . text/xml . lighttpd/1.4.35

Еще в разделе: (Показать все результаты (>14437) - mirror.msu.net/ )

... Publications . ... SPDC Laboratory . Quantum Electronics Chair . ... Intracavity generation of broadband biphotons in a thin crystal?, Laser Physics Letters, 10 (4), 045203 (2013). ... Download [ help ]: . Download paper: doi page . ... Copyright notice: This material is presented to ensure timely dissemination of scholarly and technical work. ... All persons copying this information are expected to adhere to the terms and constraints invoked by each author's copyright. ...

Еще в разделе: (Показать все результаты (>126) - qi.phys.msu.ru/ )

• Financial support :: Quantum Information Laboratory

... About Conference . ... Publications . Proceedings 2009 . Proceedings 2008 . ... Proceedings 2004 . ... Kusnetsov E.V., Safronova T.Y. Soils water-salt regime forecast by means of imitation models (2004) Pp. ... Chernavskaja N.M., Vasileva L.Yu, Dombrovskaja. V.E., Lebedeva M.V., Vasileva E.Yu. ... Gribov M.V., Irikov V.A., Ribchenko N.E., Tokareva G.V The set of tasks and algorithms of support of procedures of creation of programs of economical development of regions (2004) Pp. ...

Еще в разделе: (Показать все результаты (>13811) - www.mce.biophys.msu.ru/ )

• Publications

... 9) Oknyanskij V.L. 1994, "Optical-radio time delays in Q0957+561", Odessa Astronomical Publ., ... 11) Oknyanskij V.L. 1994, "Connection between X-ray and optical variability in NGC4151", in Proceedings of Int. Conf. ... 1994. 12) Oknyanskij V.L. 1994, "Connection between X-ray and optical variability in NGC4151", Astrophys. and Space Science, 222, p.157. ... 14) Oknyanskij V.L., van Groningen E., 1997, "Optical spectral variability of NGC4151 in 1990", Astronomical and Astrophys. ...

Еще в разделе: (Показать все результаты (>19) - uranus.sai.msu.ru/ )

• Igor Antokhin
• Elena Seifina. Publications
• Irina Glushneva

Dark matter annihilation in the Galaxy Veniamin Berezinsky Vyacheslav Dokuchaev Yury Eroshenko Institute for Nuclear Research, RAS, Moscow Laboratori Nazionali del Gran Sasso, Italy 14th Lomonosov Conference on Elementary Particle Physics DM clumps Standard cosmological scenario with an inflationary-produced primordial fluctuation sp ectrum Spike in the sp ectrum of p erturbations Clumps from isothermal fluctuations ... The solid curve shows the initial mass function. ...

Еще в разделе: (Показать все результаты (>154) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/210809/Teryaev_lom09.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/200809/Stodolsky_nuta.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/190809/Dolgov.pdf