... Proteins are principal carriers of specificity in this organization. ... In the absence of a self-sufficient high-throughput methodology for mapping of protein interactions and millions of potential specific pair-wise interactions realized within the circuitry of the cell, we focus on proteome-wide analysis of the functionalities integrated around the most important proteins, or hubs, i.e. the proteins that are highly connected, or have a great number of interacting partners. ...

Еще в разделе: (Показать все результаты (>2027) - kodomo.cmm.msu.ru/ )

• Escherichia coli AspC
• TracEnvironment тАУ Tanchiki

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>229) - www.genebee.msu.ru/ )

• RNA secondary structure prediction
• Notes on searching by similarity
• AliGraf - GeneBee Graphical Alignment Help

Shipunov A.B. Systema Naturae [Electronic resource]. 1995 onwards. ... Pyramid of kingdoms , in SVG . ... Systema Naturae or the outline of living world classification // Protistology. ... The classification has: (1) small number of kingdoms; (2) large phyla; (3) incorporating as much as possible taxonomical data from different sources. ... The classification utilizes all described groups of living organisms, excluding fossils and viruses, from kingdoms and down to the level of class. ...

Еще в разделе: (Показать все результаты (>247) - herba.msu.ru/ )

• Floristic changes on the Kem
• Behaviour of white water-lily flowers in different photoperiods
• The variability of different Drosera

... История кафедры . ... младших курсов . ... Уважаемые студенты 1-го, 2-го и 3-го курсов! ... Семинар кафедры проходит по пятницам в 15.20 в комн. ... а также на стендах кафедры на 2-м и 4-м этажах. Информацию о более ранних событиях см. в разделе "Жизнь кафедры" . ... 119991, Москва, Ленинские горы, д.1, стр.2, МГУ имени М.В.Ломоносова, физический факультет, кафедра фотоники и физики микроволн . ...

Еще в разделе: (Показать все результаты (>2) - photonics.phys.msu.ru/ )

... Main results of different objects studying using scanning probe microscopy methods are 3-dimensional images of these objects usually. ... It gives significantly more convenient image processing, but photographic quality, common for electronic microscopy methods was lost. Information obtained with scanning probe microscope is represented in a computer as numbers in 2 dimensional matrix. ... Thus, every matrix value is represented by point of some colour on a rectangular image. ... Averaging data . ...

Еще в разделе: (Показать все результаты (>127) - www.spm.genebee.msu.ru/ )

• Interests
• Femtoscan SPM
• ATOMIC FORCE MICROSCOPY VISUALIZATION OF TOBACCO MOSAIC VIRUS RNA AND TMV

МОДЕЛИРОВАНИЕ ВЗАИМОДЕЙСТВИЯ МАГНИТНОГО ПОЛЯ С ОБЪЕМНЫМИ ВЯЗАНЫМИ СТРУКТУРАМИ . ... Представлен механизм взаимодействия магнитного поля с жидкостью. В рамках концепции солитонной модели жидкости предлагается объяснение эффекта памяти в системах с водородными связями в магнитном поле. MODELING OF INTERACTION MAGNETIC FIELD WITH BULK KNITTED STRUCTURES . ... A mechanism of interaction magnetic field with liquid is pre-sented. ... Suppose the structure of such systems to be a bound band. ...

Еще в разделе: (Показать все результаты (>45) - www.library.biophys.msu.ru/ )

• Effect of Hydration on the Structure, Dynamics and Function of Photosynthetic

... Only by numerical simulation. ... moment T (K) Dipole moment (D) Experiment Other example: Diffusion constant 200 250 298 350 400 2.40 2.37 2.48 2.59 2.80 2.25 The Distribution functions: radial distribution function 1 g (r) = N t =1 j i N TS N pair ( r - rij ) The Distribution functions: radial distribution function CC def 2 Work mode ­ computer related 1) · Perform simulation , create trajectory file · Calculate properties timestep by timestep 2) · Perform ...

Еще в разделе: (Показать все результаты (>20) - www.elch.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/mole/lecture/qantipov.pdf
• http://www.elch.chem.msu.ru/mole/lecture/kiselev.pdf
• Laboratory of Electrical Double Layer and Electrode Kinetics

Next: State of development Up: Guided tour through MICO Previous: Guided tour through MICO . Modern programming languages employ the object paradigm to structure computation within a single operating system process. The next logical step is to distribute a computation over multiple processes on one single or even on different machines. ... The Common Object Request Broker Architecture (CORBA) is a specification of such a middleware platform by the Object Management Group (OMG) (see [ 5 ]). ...

Еще в разделе: (Показать все результаты (>560) - rtm-cs.sinp.msu.ru/ )

• Unions
• Qt Collection Classes
• Linux Threads Home Page: How is threading different from tasks using shared

Theory as a Lighthouse in the Electrochemical Ocean . In memory of Alexander M. Kuznetsov . ... Until his last days he continued to work on various aspects of charge transfer phenomena. ... In electrochemical kinetics the theory always outruns the experiment, and the quantum mechanical theory of charge transfer created in the famous Theoretical Department of the Frumkin Institute in Moscow (R.R. Dogonadze, A.M. Kuznetsov and co-authors) is a good example for that. ...

Еще в разделе: (Показать все результаты (>103) - electr003.chem.msu.ru/ )

• Elena V. Stenina:CV
• Maria A. Choba:CV
• Boris B. Damaskin

... What does people think about in my country? ... Some Situations are roots in communism, other are new situations created after 1990. ... In this very moment we have many private schools initiated and supported by many different ONG's. Changing the character of education . ... In Romania we need a different education system, one that is supported by society. ... The ramifications of educations system, based on the needs and the development of the economy as well as social and cultural life, go on. ...

Еще в разделе: (Показать все результаты (>119) - www.prof.msu.ru/ )

• INTERNATIONAL EXCHANGE PROGRAMS
• Training For Effective Intercultural Communication
• WHO BENEFITS FROM ENFORCING POWERFUL STRUCTURES IN RUSSIA?

... Resources . ... Eurasian Center . for Food Security . Home About About Eurasian Center for Food Security . ... Our mission: €аPromote and coordinate collective actions for strengthening food security in Eurasia through research and development. ... The ECFS Mission should be creating conditions for the development and implementation of a coherent agricultural policy that ensures soil fertility, conservation of natural resources and ensuring food security of the Eurasian region. ...

Еще в разделе: (Показать все результаты (>61) - ecfs.msu.ru/ )

• The structure of the ECFS | ECFS

Astronomy Picture of the Day . ... Credit: Hubble Heritage Team ( AURA / STScI / NASA ) Explanation: Stars come in all different colors. ... Most stars in the above Sagittarius Star Cloud are orange or red and relatively faint, as our Sun would appear. ... Stars of the Sagittarius Cloud lie towards the center of our Galaxy - tantalizing cosmic jewels viewed through a rift in the dark , pervasive, interstellar dust . ... Publications with keywords: star . ... The Quintuplet Star Cluster . ...

Еще в разделе: (Показать все результаты (>9086) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• A Small Double Ozone Hole in 2002
• Астронет > Sagittarius Star Cloud

... Home News Program Committee Organizing Committee Program Plenaries Special Sessions Registration Abstracts Accommodation Important dates Contacts Poster Links Conference Venue Video . Important dates . ... The beginning of the conference: June 17, 2008 . The closing of the conference: June 22, 2008 . ...

Еще в разделе: (Показать все результаты (>41) - pont2008.cmc.msu.ru/ )

• On mathematical creative work of L.S. Pontryagin (By D.V. Anosov) International

... Perturbation Theory has a long tradition. ... The stability of an equilibrium (or periodic) state of a system depends in the first instance on the eigenvalues of the system linearized about that state. ... After an introductory chapter on stability theory, a long Chapter 2 deals with bifurcation analysis of eigenvalues of matrices depending on several parameters: this is the core of the book on which most of the rest depends. ...

Еще в разделе: (Показать все результаты (>29) - mailybaev.imec.msu.ru/ )

• Book review by Professor Teodor M. Atanackovic

... Maxim Libanov 3 Families In 4D From 1 Family In 6D Nielsen-Olesen vortex: Ug(1) gauge eld A+scalar 2 Our 3D World is a core of AbrikosovCore of the vortex -Our 3D World There is only single vector-like fermionic r generation in 6D Chiral fermionic zero modes are trapped in the core due to speci c interaction with the A and . Speci c choise of Ug(1) fermionic gauge charges Number of zero modes = 3 Zero modes 4D fermionic families Why Neutrinos Are Different? ... Maxim Libanov Neutrinos masses. ...

Еще в разделе: (Показать все результаты (>183) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks2013/qfthep_anom_tW.pdf
• http://qfthep.sinp.msu.ru/talks2011/APopov_doklad.pdf
• http://qfthep.sinp.msu.ru/talks2013/shleenkov.pdf

... The main problem is increasing the recognition rate of some recognition engines, working in some restricted domains, such as telephone time-table question-answer systems and so on. ... Our algorithms allow user to get recognition variants, which are right sentences in some formal language. ... We suppose that BRE can produce a set of recognition variants in the form of the "complex chain". ... Length of complex chain is the number of vertexes in its graph. ... const*n^2 . ...

Еще в разделе: (Показать все результаты (>67) - www.intsys.msu.ru/ )

• Intelligent Systems :: Staff :: Zhuk Dmitriy

Distributed systems as pattern formation models: space-time behavior investigation and elements of dynamics control". ... A new method of local dynamics analysis of coupled map lattices (CML) was proposed. ... New effects of global behavior of CML was found. Maps can represent some systems. ... And the points represent state of the system, which was determined by Rybalko method (Lambda values; color = period = order, black = zero period = chaos) and the period of cycle (P values). ...

Еще в разделе: (Показать все результаты (>73) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/loskutov/PDF/Galss_ceramics.pdf
• Evolutionary motion

... Lectures : Nanomagnetism / Fundamentals I and II 1. a. b. c. d. 2. a. b. c. d. 3. a. b. c. d. e. Introduction Diamagnetism Paramagnetism Ferro-, Ferri- and Antiferromagnetism Magnetic susceptibility and permeability Magnetic order and magnetic interactions Magnetic exchange (direct, indirect, and superexchange) Dipolar magnetic interaction Spin-orbit interaction Local magnetic moments and spin-polarized electron band structure ...

Еще в разделе: (Показать все результаты (>31) - nano.msu.ru/ )

• Fundamentals of Nanotechnology, 2009 | MSU Nanotechnology Education and
• Fundamentals of Nanotechnology, 2009 | Научно-образовательный центр по
• Structure/microstructure and their interplay in nanomaterials and layered

General Information . ... Symposium expenses . ... 14 European Symposium on Gas Phase Electron Diffraction . ... The Symposium is organized by the Electron Diffraction Laboratory and the Chemistry Department of the MSU. ... Gas phase molecular structures: theory and experiment . ... We would like to stimulate deeper interaction of gas phase electron diffraction with other research fields like molecular spectroscopy, solid state electron diffraction, and electronic structure theory. ...

Еще в разделе: (Показать все результаты (>15) - ged.chem.msu.ru/ )

• Important deadlines. 14 European Symposium on Gas Phase Electron Diffraction
• Abstract submission. 14 European Symposium on Gas Phase Electron Diffraction

... Taxes and Taxpayers in Russia in the beginning of the 20th century, . ... Ezhegodnik (Economic Hystory. ... The article considers the Russian prewar tax system as an essential part of the government's general economic policy as well as an important factor of economic growth. ... In the beginning of the 20th century commercial and industrial taxes (tax on trade) amounted to half of the total of direct taxes, collected in Russia, in comparison with 20% at the end of the 19th century. ...

Еще в разделе: (Показать все результаты (>157) - hist.msu.ru/ )

• The petroleum sector of Norway. Periods of development and state adjustment.
• Labour recruiting policy and the Nobel Association of Oil Producers. A Set of
• Moscow University