... About lab . ... This project is dedicated to enhancement of microscopic images and related problems in order to simplify further analysis (by human or by computer) of such images. ... However, images acquired using described system, have a number of drawbacks, such as limited dynamic range of luminance or limited depth of field. ... The sharpest parts are selected from different images and combined together on resulting image with extended depth of field (see pic. ... Pic. ...

Еще в разделе: (Показать все результаты (>157) - graphics.cs.msu.ru/ )

• Digital Microscope | Лаборатория компьютерной графики и мультимедиа
• Smart removal of blocking effects from video | Graphics and Media Lab
• Smart removal of blocking effects from video | Лаборатория компьютерной графики

... Redox-dependent change of nucleotide affinity to the active site of the mammalian complex I. Authors: . ... A very potent and specific inhibitor of mitochondrial NADH:ubiquinone oxidoreductase (complex I), a derivative of NADH (NADH-OH) has recently been discovered (Kotlyar, A. B., Karliner, J. S., and Cecchini, G. (2005) FEBS Lett. ... Both the rate of the NADH-OH binding and its affinity to complex I are strongly decreased in the presence of succinate. ...

Еще в разделе: (Показать все результаты (>72) - biochem.bio.msu.ru/ )

• The pivotal role of the beta 7 strand in the intersubunit contacts of different
• [Different domain organization of two main conformational states of
• Effect of mutations in the beta5-beta7 loop on the structure and properties of

Wednesday, August 22nd, 2012 . GTOPO30 is a global digital elevation model (DEM) with a horizontal grid spacing of 30 arc seconds (approximately 1 kilometer)? (http://eros NULL .usgs NULL .gov/#/Find_Data/Products_and_Data_Available/gtopo30_info) . ... You are currently browsing the Лаборатория лазерной интерферометрии blog archives for August, 2012. ... Наши публикации . ... Публикации за 2010 . Публикации за 2011 . ... Лаборатория лазерной интерферометрии is proudly powered by WordPress . ...

Еще в разделе: (Показать все результаты (>39) - geo.sai.msu.ru/ )

In the past decade, cellulase enzymes became widely used for denim garment treatment as an alternative to the pumice stone-washing process in order to achieve an aged look for denim fabrics. The enzymatic process is known as biostoning process. ... As a result of biostoning process, a more uniform aged look for denim garment may be achieved. ... One of the problems arising during the denim biostoning procedure is backstaining. ... Most consumers prefer high quality jeans with low backstaining. ...

Еще в разделе: (Показать все результаты (>105) - www.enzyme.chem.msu.ru/ )

... Toric Topology studies torus actions on manifolds and cell complexes whose orbit quotients have a rich combinatorial structure. ... Research proposal by T.Panov on toric topology for 2007-2009, supported by the grant of the Pierre Deligne Foundation of 2006: English summary , proposal (in Russian) . Research proposal by T.Panov on toric topology for 2011-2013, supported by the grant of the Dynasty Foundation of 2010: English summary , proposal (in Russian) . ...

Еще в разделе: (Показать все результаты (>113) - higeom.math.msu.su/ )

• Topology section

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>15) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis
• Blocks finder
• wLake program homepage

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>137) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• TreeTop - Phylogenetic Tree prediction
• Picornaviruses: discovering big in small

... Class . ... Provides an abstraction for multidimensional array access, some concrete implementations, and ways to view a MultiArray as if it had a different structure. ... This interface defines the services required by MultiArrayProxy to manipulate indexes and the dimensions of a MultiArray. ... In the following, we use the unadorned term "array" to mean the Java language construct, and the term "multidimensional array" for the mathematical abstraction modeled by the MultiArray class in this...

Еще в разделе: (Показать все результаты (>31) - angel.cs.msu.su/ )

• : Interface Logger

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Barsukova E.A. , Goranskij V.P. , Henze M. , Shafter A.W. , Hornoch K. в журнале The Astronomer?s Telegram , ? ... Khruslov A.V. , Kusakin A.V. , Barsukova E.A. , Goranskij V.P. , Valeev A.F. , Samus N.N. в журнале Research in Astronomy and Astrophysics , издательство Institute of Physics (United Kingdom) , том 15, ? ...

Еще в разделе: (Показать все результаты (>1693) - istina.msu.ru/ )

• Tikhomirov V.S. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Delone A.B. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Yudanova Evgeniya I. - сотрудник | ИСТИНА - Интеллектуальная Система

Off-centering of impurities is an interesting phenomenon that was discovered in 1965 in KCl crystals doped with Li. ... Investigation of narrow-gap IV-VI semiconductors (mainly lead telluride PbTe and lead selenide PbSe) doped with off-center impurities (like germanium or sulfur) attracts much attention due to impurity-induced phase transitions in these incipient ferroelectrics. ... A.I. Lebedev and I.A. Sluchinskaya. ... A.I. Lebedev, I.A. Sluchinskaya, V.N. Demin and I.H. Munro. ... Russian Acad. ...

Еще в разделе: (Показать все результаты (>69) - scon155.phys.msu.su/ )

• Off-centering of Pb and Sn impurities in GeTe induced by strong local stress
• Theory of electronic properties of disordered semiconductors and systems with

THE THEORY OF ERRORS. GENERALIZATION AND ORDERING Trubnikov S.V. (Bryansk) Has appeared need of ordering and generalization of the available different approaches to a statement of the theory of errors. This generalization and ordering resulted in a new course of the theory of errors. ... 10, 2002, .387-389 E, . ... II) () x : xa = sup x - x xE x a a x - xa xa xa = sup = xa xa xE x . ... x : (5) x = sup E x ( x = inf E x ) , xe E x [ x , x ] . ... xi min xi max u : xi min [ a ] . ... 1978. ...

Еще в разделе: (Показать все результаты (>153) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc60875/doc.pdf
• http://www.mce.biophys.msu.ru/archive/doc153984/eng.pdf
• http://www.mce.biophys.msu.ru/files/mce08eng.pdf

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>42) - vestnik.math.msu.su/ )

... - behave-, believe-, blurred-, body- border- both-; ... , ... bottom-, bursary- but-, , ; ; , calculate-, capable-, , carry-, ~ away - ~out- Cartesian- case-, cause-; cathode- centre- 4 certainly-, champion- (- ), , , change-, , characterise-() characteristic-, ... weight- whereas- while-, whole-, wide-, , width- witness-, wonder- no ~ - worth- to be ~ doing smth- - Y yield- Z zinc- 35 ...

Еще в разделе: (Показать все результаты (>21) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/theses1.pdf
• http://www.eng.math.msu.su/download/Model_rendering.pdf

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>15) - comphep.sinp.msu.ru/ )

... A11, 1393, doi:10.1029/2001JA005073, 2002 Statistical distributions of field-aligned electron events in the near-equatorial magnetosphere observed by the Low Energy Plasma Analyzer on CRRES G. A. Abel,1 A. N. Fazakerley, and A. D. Johnstone2 Mullard Space Science Laboratory, University College London, Holmbury St. Mary, Dorking, Surrey, UK Received 27 August 2001; revised 26 April 2002; accepted 22 August 2002; published 22 November 2002. ... FIELD-ALIGNED ELECTRON EVENTS SMP 29 - 3 Figure 1. ...

Еще в разделе: (Показать все результаты (>86) - www.kosmofizika.ru/ )

• http://www.kosmofizika.ru/pdf2/jasp_july.pdf
• http://www.kosmofizika.ru/pdf2/july04_asr.doc
• http://www.kosmofizika.ru/pdf1/abel_02b.pdf

The dynamics of reconstitution of microtubules around the cell center after cooling I. A. Vorobjev1), Yu. ... The number of microtubules diverging radially from the mother centriole reaches a maximum after 15 to 16 min, that of microtubules growing from the daughter centriole 12 min after the cells are placed at 37 °C. 45 min after the heating started the number of radially diverging microtubules shomewhat exceeds the control level. ... I. The average number of microtubules radiating from centrioles. ...

Еще в разделе: (Показать все результаты (>44) - cellmotility.genebee.msu.ru/ )

• Italy - august 2002

. Корона . Протуберанцы . Возвращение солнца . Проблеск Меркурия? . Путь затмения . 11:03 UT 11th August 1999 . Rimnicu-Vilcea, Romania - the point of greatest eclipse . Exposures: 200mm, 200 ASA, 1/1000 f22 - 1/250 f3.5 .

Еще в разделе: (Показать все результаты (>96) - selena.sai.msu.ru/ )

• Бережной А.А.
• Solar eclipse of September 22, 1968.

In memory of Sasha Kuznetsov . Only two days ago I came back from a visit abroad to the sorrowful news that our long-time good colleague and friend, a sparkling and noble personality, Alexander Mikhailovitch Kuznetsov, to me and many others, Sasha, had passed away. ... This applied both to his own realm of molecular charge transfer phenomena but also in his interests in broader areas of condensed matter chemical physics. ... Sasha enjoyed high and increasing international respect. ... Back ...

Еще в разделе: (Показать все результаты (>62) - electr003.chem.msu.ru/ )

... It could operate only in the early universe and disappeared without trace today; at odds with Occam razor, but nevertheless it must operate in the early universe if there exists any complex scalar field with m < Hinf . ... Compact anti-ob jects mostly survived in the early universe, especially if they are PBHs. ... Such "stars" may evolve quickly and, in particular, make early SNs, enrich the universe with heavy (anti)nuclei and re-ionize the universe. ... Compact stellar-like ob jects. ...

Еще в разделе: (Показать все результаты (>167) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/lpp14/190809/Early%20physics%20with%20Atlas%20at%20LHC.pdf
• http://nuclphys.sinp.msu.ru/conf/epp10/Belokurov.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/220809/Demidov.pdf

... JAPANESE PROGRAM 2016 1st term [TUJP-1]: July 4th to July 19th, 2016 2nd term [TUJP-2]: July 25th to August 9th, 2016 What's TUJP? This summer intensive program provides students of our partner institutions with an opportunity to discover Japan through diverse learning experiences in English. ... PROGRAM SCHEDULE 1st term [TUJP-1]: Monday 4th July, 2016 to Tuesday 19th July, 2016 2nd term [TUJP-2]: Monday 25th July, 2016 to Tuesday 9th August, 2016 Applying for two consecutive terms (ex. ...

Еще в разделе: (Показать все результаты (>107) - phys.msu.ru/ )

• http://phys.msu.su/rus/news/latest/programme_lectures_MSU_Farle_2014.pdf
• Title