. Карты глубинных срезов для 12 уровней (синее - скорость выше стандартной, красное - ниже ) (для увеличения масштаба - нажать на картинку)

Еще в разделе: (Показать все результаты (>17) - sbmg.geol.msu.ru/ )

• Zhou: P1200 Mantle Model
• Su et al. Mantle Heterogeneity

. Name . Last modified . Size . Description . Parent Directory . - . АКЛ для МК final.doc . 31-Oct-2005 10:43 . 1.1M . Apache/2.2.16 (Debian) Server at www.kosmofizika.ru Port 80

Еще в разделе: (Показать все результаты (>101) - www.kosmofizika.ru/ )

... download [ 61679 ] . Effects of the Seafloor Topography on Tsunami Generation Explored for the Messina 1908 tsunami through 2-D finite element modeling . ... What Evidence Exists for Paleotsunami Triggered by Local Earthquakes in the Wellington Region of New Zealand? ... Didenkulova I. I. and Pelinovsky E. N. (Russia) . ... Near-Shore Oceanic Earthquakes: Application of Acoustic Methods to Detect Earthquake Precursory Phenomena and Possible Improvements of Tsunami Warning Systems . ...

Еще в разделе: (Показать все результаты (>26) - seac47-2.phys.msu.ru/ )

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Modules . ... mod_ext_filter presents a simple and familiar programming model for filters . ... any programming/scripting language can be used, provided that it allows the program to read from standard input and write to standard output . existing programs can be used unmodified as Apache filters . ... mod_ext_filter directive to define a filter . ... program /usr/bin/enscript, with the type of . ...

Еще в разделе: (Показать все результаты (>453) - itpm.msu.su/ )

• Changes between HTML 3.2 and HTML 4.0
• Performance, Implementation, and Design Notes

... The software models the dynamics of RNA secondary structure by the means of kinetic analysis of folding transitions of a growing RNA molecule. The result of the modeling is a kinetic ensemble, i.e. a collection of RNA structures that are endowed with probabilities, which depend on time. ... 19, Moscow, 127994, Russia. ... Danilova, L.V., Pervouchine, D.D., Favorov, A.V., Mironov, A.A. (2006) RNAKinetics: a web server that models secondary structure kinetics of an elongating RNA. ...

Еще в разделе: (Показать все результаты (>18) - bioinf.fbb.msu.ru/ )

• RNA Kinetics: Theory

.

Еще в разделе: (Показать все результаты (>362) - www.chemport.ru/ )

• Химия во всех проявлениях - Химический портал ChemPort.Ru

SVETKA, a program for Analysis of Multiple Sequence Alignments . ... T his is a database of some analysed "model" alignments. These sets of amino acid sequences were taken from COGs database . ... Results of the analysis of "model" alignments are acceptable from the table below. Every alignment is called VAL xxxx , where xxxx is the number of the original COG (e.g. VAL1188 is obtained from COG1188 ). Alignment name . ... of sequences . Alignment length . Alignment quality . ...

Еще в разделе: (Показать все результаты (>456) - monkey.belozersky.msu.ru/ )

... Shown that this calculation method may be applied for optimal completed of the laser cavities by the mirrors. ... 4]. , ( ) - sin j co s j Mj = pj (1 ) , - p sin co s j j j sin 2 1 1- j = arccos 2 2 nj , n j h j cos j , p j = n j cos j , j = 1- , - . ... rTE rTM . ... R = r r* ; TE TE TE : rTE = arctg Im rTE Re rTE rTM = arctg , Im rTM Re rTM - : : 0 rTM expi 2 Z= 0 - rTE exp - i 2 . ... M cw M ccw : M ccw =M cw cos( = si n ( ) ) - sin ( ) = S ( ) , cos( ) - . ... 11° L16. , (6). 10q 01(q+1), . ...

Еще в разделе: (Показать все результаты (>191) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/mirrors/2001_2c.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/240809/Pavlovsky.pdf
• http://nuclphys.sinp.msu.ru/nseminar/shirokov.pdf

Here are examples of an alignment for input for the program " LCore ". ... 1NK2 (TGTGTCAAGTGGCTGT):A.P/1 (ACAGCCACTTGACACA):B.P/1 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/1 1NK2 (TGTGTCAAGTGGCTGT):A.P/2 (ACAGCCACTTGACACA):B.P/2 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/2 1NK2 (TGTGTCAAGTGGCTGT):A.P/3 (ACAGCCACTTGACACA):B.P/3 (ASDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHP):P.CA/3 ...

Еще в разделе: (Показать все результаты (>6995) - mouse.belozersky.msu.ru/ )

• wLake program homepage
• Index of /npidb/pdb

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>140) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika

... Геоморфологии и палеогеографии . Географии мирового хозяйства . ... Гидрологии суши . ... Выберите кафедру . ... Ученый совет . ... Образование . ... Научно-методический совет по экологии Министерства образования и науки РФ . ... model_K37 . ... Кафедра геоморфологии . ... Все сообщения пользователя . ... Текст cooбщения . ... Кафедра геоморфологии Кафедра гидрологии . ... Информация о предстоящих защитах диссертаций на соискание ученой степени кандидата, доктора географических наук Подробнее . ...

Еще в разделе: (Показать все результаты (>270) - www.geogr.msu.ru/ )

... One of the project objectives was to investigate practical efficiency of some modern iterative methods, including multigrid techniques and domain decomposition methods as well as methods for small compressible materials. ... Hence, the project research initiated because of INTAS financial support contributes in setting up modern computational techniques in tire design. ... Research on efficiency of iterative methods was conducted at the department of Mechanics of Composites about ten years ago. ...

Еще в разделе: (Показать все результаты (>5) - composite.msu.ru/ )

Lomonosov project . News . ... Mikhail Lomonosov . Scientific goals . ... Scientific equipment . ... UFFO . ... April 12, 2011 . The weight-dimension and thermal models of scientific equipment blocks of the spacecraft are delivered to R&D Institute of Electromechanics ? ... Discussed issues related to the flight model of  UFFO device. The scientific equipment systems were joined with UFFO block. ... Debugging and joining of scientific equipment with UFFO block were made. ...

Еще в разделе: (Показать все результаты (>26) - lomonosov.sinp.msu.ru/ )

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... It is necessary to note that a change-point detection method which we applied to a real EEG signal was developed on the basis of the piecewise stationarity model of the signal. ... The data presented in this Chapter demonstrate that the effective detection of the change-points opens the way for a number of new methods of the analysis of complex signals such as the EEG. ...

Еще в разделе: (Показать все результаты (>67) - brain.bio.msu.ru/ )

• Parametric segmentation of the EEG

. Название публикации . T-cadherin suppresses the cell proliferation of mouse melanoma B16F10 and tumor angiogenesis in the model of chorioallantoic membrane . Авторы . E.I. Yurlova, K.A. Rubina, V.Yu. Sysoeva, G.V. Sharonov, E.V. Semina, Ye.V. Parfenova, V.A. Tkachuk . Дата . 31.12.2009 23:00:00 . Название журнала . Cell Differentiation and Proliferation. Том . Vol.41 . Номер . 4. первая страница . 217 . последняя страница . 226. Купить нет на складе . 2009 ФФМ МГУ, 2009

Еще в разделе: (Показать все результаты (>9) - fbm.msu.ru/ )

.

Еще в разделе: (Показать все результаты (>3) - lab110.imec.msu.ru/ )

• Laboratory of Mechanics of Multiphase Media

... In the given practical special course we address user techniques for working with Linux OS; we study the interface of the command line in great detail, methods of automation and batch processing, composition of scientific articles as well as the specifics of software design by using in-built toolkit. ... The first version of the nucleus of Linux operating system was written more than 20 years ago by a student, just like you, as his second-year coursework. ... Sekunov N. Programming on C++ in Linux. ...

Еще в разделе: (Показать все результаты (>17) - engineering.phys.msu.ru/ )

• FPGA Design
• Microcontroller Programming

... For the investigations of the phenomenon leading to non inflation (squidding) of parachute, the influence of canopy permeability and upstream flow on the character of pressure distribution along framework model, imitating round parachute, was studied experimentally. ... The pressure sensors: 13 ones inside and 13 - outside the canopy have been placed for the study of distribution of internal and external pressure on the surface of the model. ... Variant 1. ... Parachute Science] . ...

Еще в разделе: (Показать все результаты (>7) - margaret.imec.msu.ru/ )

... There are three political actors developing and implementing the educational policy: the state, the market and academia. Depending on the role of each of these actors the educational policy models are defined. ... Given the modern tendencies of globalization, the study of educational policy models changes in the light of new institutional environment of Bologna process. ... Educational policy, educational policy models, educational policy actors, public and private partnership, Bologna process. ...

Еще в разделе: (Показать все результаты (>169) - ee-journal.spa.msu.ru/ )

Moscow State University Belozersky Institute of Physico-Chemical Biology . Department of Electron Microscopy is a sub-division of A.N. Belozersky Institute of Physico-Chemical Biology . ... We are interested of how eukaryotic cell is organized, formed and functioned. Since A.N. Belozersky Institute of Physico-Chemical Biology is one of the scientific departments of Moscow State University ? ... Understanding the metaphase chromosome architecture remains a basic challenge in cell biology. ...

Еще в разделе: (Показать все результаты (>3) - cellbiol.genebee.msu.ru/ )