... Physics Department . Russian Academy of Sciences . ... Source: www.utro-russia.ru , . 08.12.2010 . ... The news are available in Russian only . Seminar of the Polymer Council of RAS . Seminar in Polymer Physics . Seminar in Electrochemistry ...

Еще в разделе: (Показать все результаты (>392) - polly.phys.msu.ru/ )

• Internal Information Services - Chair of Polymer and Crystal Physics
• KTiOPO4-FAMILY CRYSTALS
• Scientific

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

Lessons learned from the Thirty Meter Telescope site testing Tony Travouillon Sebastian Els, Angel Otarola, Reed Riddle, Matthias Schoeck, Warren Skidmore TMT.XXX.PRE.05.0XX.DRF01 1 Introduction TMT and its Site testing. Important choice before going on site. ... Considerations during analysis of the data. TMT.XXX.PRE.05.0XX.DRF01 2 Some Background about the TMT Site Testing TMT is a 30m, segmented, RitcheyChretien telescope design. ... ASCA Cloud Cover Analysis So how do we do it in practice? ...

Еще в разделе: (Показать все результаты (>196) - site2010.sai.msu.ru/ )

Официальный сайт кафедры Математической теории интеллектуальных систем и . ... Сотрудники . ... Сотрудники :: Гасанов Эльяр Эльдарович :: Публикации Гасанова Э.Э. ABSTRACT . ... Say is an instantly solvable search problem if there exist algorithm , solving , such that . ... Then ISP (which is called problem of search of identical objects) is instantly solvable search problem, and . ... Then ISP (which is called -dimensional interval search problem) is instantly solvable search problem, and . ...

Еще в разделе: (Показать все результаты (>45) - www.intsys.msu.ru/ )

• Intelligent Systems :: Teaching :: Seminars :: Список специальных семинаров

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Re: DII - no realms are available right now [ re: doctor ] . ... Re: DII - no realms are available right now [ re: Карбофос ] . ...

Еще в разделе: (Показать все результаты (>4307) - www.fds-net.ru/ )

• Скажем Ramir'y громкое "фи". - Public forum of MSU united student networks
• [News] Научное программное обеспечение - Public forum of MSU united student
• Mass Effect - версия для PC вышла - Public forum of MSU united student networks

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>17) - tukachev.flogiston.ru/ )

• Category: Новости

Database: . ... Affymetrix official site . ... Clone/Gene ID converter . ... Probe set search: . Affymetrix probe set identifier example: "238900_at" . ... Search . Text search: . Gene official symbol (*-wildcard) example: "c1orf*" . Word or phrase in gene official name example: "receptor" . ... Gene search: . ENSEMBL gene identifier example: "ENSG00000026508" . NCBI Entrez Gene identifier example: 7503 . HUGO gene identifier example: 1681 . ...

Еще в разделе: (Показать все результаты (>17) - mouse.belozersky.msu.ru/ )

• Geometrical core
• Alignment example
• Example of alignment

Fabrik . A Visual Programming Environment . ... Fabrik is a visual programming environment - a kit of computational and user-interface components that can be "wired" together to build new components and useful applications. ... Figure 1a . ... F/C component used in the diagram . ... Figure 3 shows the complete Fabrik diagram for the slider component used in the Fahrenheit-to-Centigrade example of figure 2a. Several labels have been made visible, using an option available in the Fabrik interface. ...

Еще в разделе: (Показать все результаты (>86) - sp.cs.msu.ru/ )

• Development of portable program system
• Design Principles Behind Smalltalk

... Laboratory of Mathematical Methods of Image Processing . ... Image analysis . ... Ringing effect . ... Ringing effect so known as Gibbs phenomenon in mathematical methods of image processing is the annoying effect in images and video appeared as rippling artifact near sharp edges. ... Ringing effect is usually introduced to image after different image processing algorithms. ... Scale-space method of image ringing estimation // In: Proceedings of International Conference on Image Processing (ICIP'09)...

Еще в разделе: (Показать все результаты (>126) - imaging.cmc.msu.ru/ )

• Software projects | Laboratory of Mathematical Methods of Image Processing
• Ringing effect modeling | Laboratory of Mathematical Methods of Image...

... H: · 1 ­ Al2O3­Na3AlF6 (T - x) = 1 , ­ , ­ 1 ( ­ ); · 1 ­ Na2SO4­H2O (T - x) = 1 ( ); · 25° ( .. ... Na2SO4­H2O Na2SO4 10H2O, Na2SO4 + 10H2O Na2SO4 10H2O. , , , . ... 6, 7) LiBr KBr, , : L LiBr() + KBr() . ... 1) , , KBr. ... L. PbTe­SnTe PbSe­SnSe PbTe PbSe, , (.. ... BeF2­LiF , ( ), LiBeF3 Li2BeF4 BeF2­LiF (. ... LiBeF3 280°, BeF2 Li2BeF4 : LiBeF3 () ­ Na2SO4 7H2O: Na2SO4 + 7H2O Na2SO4 7H2O. : Na2SO4 7H2O() Na2SO4 10H2O() Na2SO4 () Na2SO4 () +L 24° BeF2 () + Li2BeF4 () . ... Na2SO4­H2O Na2SO4­H2O....

Еще в разделе: (Показать все результаты (>55) - www.inorg.chem.msu.ru/ )

... Acid effect on multilayer oil reservoirs" . Zakirov T.R., Nikiforov A.I. The effect of hydrochloric acid on a layered heterogeneous stratum is considered. ... PDF (in Russian) (300KB) . PDF. zip (in Russian) (233KB) . Zakirov T.R., e-mail: timurz0@mail.ru ; Nikiforov A.I., e-mail: nikiforov@mail.knc.ru тАУ Institute for Mechanics and Engineering, Kazan Science Center, Russian Academy of Sciences; ulitsa Lobachevskogo, 2/31, Kazan 420111 Russia ...

Еще в разделе: (Показать все результаты (>213) - num-meth.srcc.msu.ru/ )

• Mathematical modeling of multicomponent gas flows with energy intensive
• "A method of red-eye effect recognition in digital photography"
• "Relativistic breaking effect of electron oscillations in a plasma slab"

Please enter the lightcurve file name and period search parameters: . Lightcurve file: . ... Apply the Heliocentric correction and convert all dates to Terrestrial Time (TT)? ... Phase range for plots: -0.5 to 1.0 0.0 to 2.0 0.0 to 1.0 . ... Also, the Heliocentric correction cannot be applied to such lightcurves. ... Two period search methods are currently implemented. ... This period search service is also available at the mirror sites: Mirror 1 , Mirror 2 , Mirror 3 , Mirror 4 . ...

73. Local field and optical second harmonics generation in polar Langmuir-Blodgett

74. http://lnfm1.sai.msu.ru/grav/russian/life/chteniya/sagi2007/turyshev_Anomaly.pdf

75. Effects of Acid Deposition on Forest Soils in Northernmost Russia: Modelled and

76. http://danp.sinp.msu.ru/Articles_GSIB/nimb206_830_GCIB_Applications_Equipment.pdf

77. Gus Koehler. Useful Hints for Reordering the Universe

78. SPAW Editor documentation

79. Advanced Quantum Field Theory

80. Irina Glushneva