... ЭОС истфака МГУ . ... x25BA; Кафедра исторической информатики . ... Course categories: Кафедра истории средних веков Кафедра исторической информатики Кафедра исторической информатики / Практика использования ДОТ Кафедра истории России до начала XIX века Кафедра новой и новейшей истории стран Европы и Америки Кафедры этнологии Археографическая лаборатория Школа учителей истории . ... Информационные технологии и математические методы в исторических исследованиях и образовании . ... Home ...

Еще в разделе: (Показать все результаты (>4339) - www.hist.msu.ru/ )

• ЭОС истфака МГУ: Course categories
• Электронная образовательная среда исторического факультета МГУ имени
• ЭОС истфака МГУ: Практика использования ДОТ

... The case is that in a current status our mailing list is unmoderated, so . ... You may also address majordomo@fadr.msu.ru with the following commands: . ... Put each command on a line by itself. ... about which you wish information is "demo-list", you would put the line . ... To receive list mail at the address from which you're sending your mail, . ... may simply send the command "unsubscribe" followed by the list name: . ... To find the lists to which your address is subscribed, send this command ...

Еще в разделе: (Показать все результаты (>127) - www.fadr.msu.ru/ )

• http://www.paleopedology.msu.ru/discussions/messages/51.html
• http://www.paleopedology.msu.ru/discussions/messages/354.html
• http://www.paleopedology.msu.ru/discussions/messages/250.html

... Master Education . Second Education . Additional Education . ... Master programs . ... Request new password . Username: * . Enter your Магистерское и послевузовское образование username. Password: * . Enter the password that accompanies your username. ... Магистратура: master@cmc.msu.ru, 3-й этаж, комната 360, тел. 495) 939-23-59, (495) 939-17-73, . Второе высшее образование: second_edu@cs.msu.ru, 6-й этаж, комната 640, тел. ... 495) 939-57-93 . ...

Еще в разделе: (Показать все результаты (>47) - hcs.cmc.msu.ru/ )

... For the past years I have been working on the problem of synthesis of light curves of close binary systems, consisting of a normal star and a compact object (point object with fixed X-ray luminosity). ... Possible existence of a bright spot on the disk's lateral surface is taken into account. ... The last of then will be published in Gordon and Breach Publishers ( Cherepashchuk A.M., Katysheva N.A., Khruzina T.S., Shugarov S.Yu. ... Cherepashchuk A.M., Katysheva N.A., Khruzina T.S., Shugarov S.Yu. ...

Еще в разделе: (Показать все результаты (>11) - uranus.sai.msu.ru/ )

• SAI graduates 1982

... Control question . Control answer . GEA is a system for the analysis of micro-array experiments results. It includes modules for background correction an normalization ( NM stage ), principal component analysis ( PCA stage ), clusterization ( CL stage ), quality control ( QC stage ), and main vector determination ( MV stage ). ... It is based on the evaluation of eigenvalues and eigenvectors in the gene space and the analysis of eigenvectors that correspond to the greatest eigenvalues. ...

Еще в разделе: (Показать все результаты (>160) - www.genebee.msu.ru/ )

• Genebee Predicted Annotation
• INTAS :: Global and Local Protein Matching
• BLAST Frequently Asked Questions (FAQ)

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... Log In or Register . Main . Staff . Publications . Journals . Conferences . Contacts . ... Login: . ... Remember me on this computer . ... You can log in if you are registered at one of these services: . ... Institute of Computer Science Izhevsk, 2005 - 2016 . ...

Еще в разделе: (Показать все результаты (>107) - ics.org.ru/ )

... User account . Create new account (active tab) . ... E-mail address * . A valid e-mail address. All e-mails from the system will be sent to this address. The e-mail address is not made public and will only be used if you wish to receive a new password or wish to receive certain news or notifications by e-mail. ... Language settings . Language . ... This account's default language for e-mails. ... MSU website . ... 2006-2016 MSU Higher School of Management and Innovation. ...

Еще в разделе: (Показать все результаты (>28) - hsmi.msu.ru/ )

• Opening of the educational programme - School of CEOs, "Capsule of security"
• School overview | MSU Higher school of management and innovation
• MSU Higher school of management and innovation |

You may log in as Guest (no editing) . E-mail . Guest E-mail . guest@guest.dum . Password . Guest Password . Gpassword . E-mail . Fill in all fields . Enter your e-mail address . Password . Reenter password . First name . Last name . Birthday . (в формате dd.mm.yyyy) . Sex . М Ж . Check up all data. You cannot change them later .

Еще в разделе: (Показать все результаты (>280) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/ongoing_projects.html

Online Services | ... Nuclear Wallet Cards" . USA National Nuclear Data Center - NNDC . ... Nuclei Selection: . All nuclei Only even Only odd . ... Decay Type: . decay . ... CDFE Head: Vladimir V. Varlamov . ...

Еще в разделе: (Показать все результаты (>24) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Nucleus Ground State Parameters

Moscow State University Geological Faculty, Department of Geophysics . ... The signs of distortions on VES data and their role for data interpretation . ... TES field technology . ... Data processing and interpretation . ... Data visualization for TES technology. ... Field example. ... In MSU this technology appeared in 1991. ... TES modification consists of the four interconnected technologies: field measurements, data processing, visualization and interpretation. ... E-mail: sh@geophys.geol.msu.ru . ...

Еще в разделе: (Показать все результаты (>64) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TRF_2d. Page 3.

... in contrast to smth -showing a difference between people, ideas, situations, things etc that are being compared to a lesser extent-used to say how true smth is or how great or small an effect or change is globally-affecting or including the whole world overall-considering or including everything on the whole anyway-admitting that what was said before doesn't matter, this is the main point but-used to connect two statements or phrases when the second one adds ...

Еще в разделе: (Показать все результаты (>23) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/Model_rendering.pdf
• http://www.eng.math.msu.su/download/business_english2.pdf
• http://www.eng.math.msu.su/download/Academic_English_part2.pdf

... Paradigm shifts by Kuhn: successive change of one model by another, rather than integration of different paradigms Progress of science: from single- to multi-model approach Some examples from natural science... · theory of light: from vibration of ether to wave-particle duality · laws of motion: from Newton's dynamics to SchrЖdinger 's and Heisenberg's formalism In social and environmental sciences appreciation of the multi-model ...

Еще в разделе: (Показать все результаты (>3) - oc.cs.msu.ru/ )

... Наш факультет . ... Полезные ссылки . ... Научная жизнь на факультете . ... Гуманова Ю.Л., Королева-МакАри В.А., Свешникова М.Л., Тихомирова Е.В. 'The Best of Just English' . ... We believe that English learners at law school should be able to make sense of sophisticated legal texts and deal with their clients, be involved in legal disputes where a good command of the English language is vital. ... Victor Sadovnichy congratulates the Just English team on the launch of The Best of Just English. ...

Еще в разделе: (Показать все результаты (>72) - ffl.msu.ru/ )

• About Us

ERROR: You need to create the directory /home/www/hist/vledata with web server write access . ... В настоящее время материалы дистанционной поддержки к курсам, читающимся на историческом факультете МГУ им. М.В.Ломоносова, вы можете найти по адресу: vle.hist.msu.ru Skip Calendar . ...

Еще в разделе: (Показать все результаты (>37501) - hist.msu.ru/ )

Electronic Proposal Submission Service - EPSS preparation and submission guide - Release Date: 5 May 2008 Table of Contents 1 1 .1 . ... Using PIC in EPSS.. ... 29 EPSS help desk Phone: +32 2 23 33 760 Email: support@epss-fp7.org EPSS User Manual Released on 5 May 2008 page 2 of 29 1 EPSS Preparation ­User's Guide The EPSS (Electronic Proposal Submission Service) allows Proposers to create their proposal completely on-line without downloading or saving anything on their local personal computer. ...

Еще в разделе: (Показать все результаты (>25) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/press_release_2011.pdf

... An hour later, the satellite has proceeded to higher altitudes and the auroral proton precipitation pattern can be seen, using the SI-12 proton imager. ... The IMF dependence of the proton cusp signature has been described at length recently in several papers by Frey et al. [2002, 2003]. movie of this event This is just the first indication of activity and this storm is a continuing event, now with (a possibly unprecedented) 2 successive dips of DST below -300 nT. ... Proton aurora in the cusp . ...

Еще в разделе: (Показать все результаты (>67) - www.kosmofizika.ru/ )

• Science Technology: Ongoing Solar Activity