... Начало www.99ru.ru Книги о РУСИ Славянская традиция 8265 . ... Искусство . История.Философия . ... Художественные . ... История Всемирная . ... Искусство и культура . ... Другие виды искусства . ... Этнография Фольклор . ... Наследие Востока . ... Введите код товара из каталога. автор Велецкая Н.Н. Символы славянского язычества. руб. ... Велецкая Н.Н. Символы славянского язычества. ... Автор этой книги, отечественный славист с мировым именем - Наталья Николаевна Велецкая, делает такую попытку. ...

Еще в разделе: (Показать все результаты (>41) - www.bukivedi.ru/ )

Lomonosov project . News . ... Mikhail Lomonosov . Scientific goals . ... Scientific equipment . ... July 8, 2012 . ... May 10, 2012 . The entrance control of cable system of scientific equipment ?Lomonosov? successfully completed. ... Input control tests of scientific equipment ?Lomonosov? devices is held in NIIEM. December 15, 2011 . Preparations for testing the dynamic module of scientific instruments for satellite ?Lomonosov? is finished. November 30, 2011 . ...

Еще в разделе: (Показать все результаты (>26) - lomonosov.sinp.msu.ru/ )

• Mikhail Lomonosov ? the Pioneer of Russian Science | Университетский спутник

... A hybrid heuristic parallel method of global optimization" . ... A hybrid heuristic parallel method for solving of complicated global optimization problems is proposed. ... The method is compared with 21 modern methods of global optimization and with a genetic algorithm using 28 test objective functions of 50 variables. Keywords: global optimization, heuristic methods, neural networks, parallel computing, C++, MPI. ...

Еще в разделе: (Показать все результаты (>254) - num-meth.srcc.msu.ru/ )

• "Special stochastic representation of quantum mechanics and solitons"
• "A practical approach to the interaction between a computing cluster monitoring
• "Application of parallel programming tools for the solution of fluid dynamics

... Abstract A Uniform Resource Identifier (URI) is a compact string of characters for identifying an abstract or physical resource. ... This document defines a grammar that is a superset of all valid URI, such that an implementation can parse the common components of a URI reference without knowing the scheme-specific requirements of every possible identifier type. ... URI-reference = [ absoluteURI | ... Otherwise, the reference URI's scheme is inherited from the base URI's scheme component. ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1945.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1808.txt

. A program for alignment of structures of DNA-protein complexes . Home . Feedback . Help . About . Input PDB code of the first complex: and chain of the protein (optional): . Input PDB code of the second complex: and chain of the protein (optional): . If you get stuck with program input, try example data and click Align! Example data . 2016

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• ConClus
• Nhunt

... TernAPI program . ... TernAPI program is designed for ternapy phase diagrams calculation by means of the convex hull method. ... Quick calculation of isobaric-isothermal sections of ternary systems phase diagrams (1-30 sec.) ... Voskov A.L., Dzuban A.V., Maksimov A.V. TernAPI program for ternary phase diagrams with isolated miscibility gaps calculation by the convex hull method // Fluid Phase Equilib . ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>8) - td.chem.msu.ru/ )

• PhDi Laboratory of Chemical Thermodynamics

Unity in the name of the Higher School I.B. Fedorov, Chairman of Rectors' Council of Moscow and Moscow Region, Rector of Moscow State Bauman Technical University, Corresponding Member of Russian Academy of Sciences. ... They help to think anew those events, which are still extremely important many years later. ... Even more, inside the higher school itself, skeptical mood prevailed at that time - just another senseless organization to waste time and efforts. ...

Еще в разделе: (Показать все результаты (>31) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/274.doc
• http://www.rsr-online.ru/doc/norm/396.doc
• http://www.rsr-online.ru/doc/norm/526.doc

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>7) - storage.bioinf.fbb.msu.ru/ )

... Next: Fast probe landing and Up: Client Previous: Photodiode (AFM mode) Contents Index . FemtoScan `` client-program has a number of additional commands to work with during scanning. These commands allow to execute some special operations on microscope control and interface configuration. ... Fast probe landing and retraction . ... Images saving mode . ... Next: Fast probe landing and Up: Client Previous: Photodiode (AFM mode) Contents Index Filonov 2005-02-04 ...

Еще в разделе: (Показать все результаты (>138) - www.spm.genebee.msu.ru/ )

• Fast probe landing and retraction
• DNA-surfactant complexes in organic media
• Features searching

Example of Divergent Fourier Series over Rearranged Walsh-Paley System / Polyakov I.V. // Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>137) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Instructions
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 4/2012
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 6/2012

Форум МГУ Главная Помощь > . ... BB-коды . ... Делает выделенный текст полужирным, наклонным, подчеркнутым или зачеркнутым. Пример: . Это [B]полужирный[/B] текст. ... Вывод: . ... Изменяет цвет, шриф или размер выделенного текста. ... Создать ссылку из выделенного текста. ... URL]http://www.example.com[/URL] . ... Делает выделенный текст ссылкой на интернет-страницу или адрес e-mail. ... Показывает картинку, используя выделенный текст как URL . ... Увеличивает отступ выделенного текста. ...

Еще в разделе: (Показать все результаты (>24) - osk.msu.ru/ )

ISSN 1560-3547, Regular and Chaotic Dynamics, 2015, Vol. ... The Dynamics of Systems with Servoconstraints. ... The presence of symmetries allows one to reduce the dynamic equations to a closed system of differential equations with quadratic right-hand sides on a Lie algebra. ... If v (x) = 0 for x = 0, then the system (3.1) admits an invariant straight line x = , where is a nonzero vector from Rp and the parameter changes with time according to the differential equation = c2 , c = 0. ... Theorem 2. ...

Еще в разделе: (Показать все результаты (>135) - ics.org.ru/ )