... M_K : Re: [News] Научное программное обеспечение [re:bmv] 26.09.2008 14:12 | ... 2D formatted math display : wxMaxima implements its own math display engine to nicely display maxima output. ... It adds support for mask transparency and adds new mask properties. ... The toolbox skeleton is now released into the public domain to facilitate the reuse of the code . ... R, like S, is designed around a true computer language, and it allows users to add additional functionality by defining new functions. ...

Еще в разделе: (Показать все результаты (>4986) - www.fds-net.ru/ )

• запись образа флеш-диска. как? - Public forum of MSU united student networks
• could someone tell me where the chinese chat room locates here? - Public forum
• Re: [News] Научное программное обеспечение - Public forum of MSU united student

... Выпускники . Выпускники ВМиК . ... Женский клуб . ... Издательство МГУ . ... Конференции . ... Новости для выпускников . МГУ им.Ломоносова . ... База данных выпускников . ... Выпускники МГУ . ... Дайв-Клуб МГУ . ... Добавить сообщение . ... Автор: Bambarbia . ... http://www.quantcast.com/tokenizer.org/traffic . ... http://www.tokenizer.org/submitUrl.do . ... Ответить на сообщение . Автор: Funtick . ... Автор: Виктор . ... Funtick пишет 22.01.2007 22:27: . ... Дата: 22.01.2007 22:35 . ...

Еще в разделе: (Показать все результаты (>373) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Ученые нашли у мумий признаки атеросклероза
• Клуб выпускников МГУ: Meeting in Toronto, June 27, 2009

Unity in the name of the Higher School I.B. Fedorov, Chairman of Rectors' Council of Moscow and Moscow Region, Rector of Moscow State Bauman Technical University, Corresponding Member of Russian Academy of Sciences. ... They help to think anew those events, which are still extremely important many years later. ... Even more, inside the higher school itself, skeptical mood prevailed at that time - just another senseless organization to waste time and efforts. ...

Еще в разделе: (Показать все результаты (>23) - www.rsr-online.ru/ )

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... This is a modification of the original Camera Calibration Toolbox for Matlab by Jean-Yves Bouguet that adds automatic calibration object detection to the functions of the original toolbox. ... The source code can be downloaded lower in this page. v0.31b Download GML Matlab Camera Calibration Toolbox 0.31 11.05.2005 Re-compiled and added correct OpenCV dlls . ... C++ Camera Calibration Toolbox . ...

Еще в разделе: (Показать все результаты (>238) - graphics.cs.msu.ru/ )

• GML Matting | Graphics and Media Lab
• Removal of comb effect from video | Лаборатория компьютерной графики и
• Removal of comb effect from video | Graphics and Media Lab

Cell Biology International 27 (2003) 293­294 Cell Biology International www.elsevier.com/locate/jnlabr/ycbir Short communication Microtubule dynamics in living cells : direct analysis in the internal cytoplasm Ivan A. Vorobjev a a,* , Irina B. Alieva a, Ilya S. Grigoriev b, Gary G. Borisy c Laboratory of Cell Motility, A.N. Belozersky Institute, Moscow State University, Moscow, Russia b Department of ... These data demonstrate that MT growth is impeded at the cell margin. ...

Еще в разделе: (Показать все результаты (>28) - cellmotility.genebee.msu.ru/ )

• http://cellmotility.genebee.msu.ru/html/articles/Alieva04.pdf
• http://cellmotility.genebee.msu.ru/html/articles/alieva2000.pdf

with Materials Atoms Nuclear Instruments and Methods in Physics Research B xxx (2005) xxx­xxx www.elsevier.com/locate/nimb ITO surface smoothing with argon cluster ion beam C. Heck a a,* , T. Seki b, T. Oosawa c, M. Chikamatsu c, N. Tanigaki a, T. Hiraga a, J. Matsuo b c Laboratory of Purified ... Results show that relatively low-energy (10 keV) clusters with mean size of 2000 Ar atoms are sufficient to reduce the mean roughness of the ITO surface to about one fourth of its initial value. ...

Еще в разделе: (Показать все результаты (>87) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/Articles_GSIB/nimb206_830_GCIB_Applications_Equipment.pdf
• http://danp.sinp.msu.ru/Articles_GSIB/nimb_sputteryield_sizeclasterion.pdf
• http://danp.sinp.msu.ru/Tulinov_85/NIMB267(2009)2592-AFT.pdf

О лаборатории . ... Лаборатория теоретической биофизики . ... This Python module parses Gaussian cube files, produced by quite a few QM software packages, and makes volume data available as numpy array as well as some associated properties. ... Нет комментариев " Gaussian Cube files loader " . ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>29) - erg.biophys.msu.ru/ )

• Peter Mamonov ERG Research Group: Лаборатория теоретической биофизики
• All-atom automatic OPLS-AA topology generator ERG Research Group: Лаборатория
• cp2k ERG Research Group: Лаборатория теоретической биофизики

... Department . ... Department of the Automation for Scientific Research (ASR) was founded in 1988 on the basis of research and teaching group of the Mathematical Physics Department (former Department of Computational Mathematics). ... Under his guidance the department performs wide spectrum of research in the field of computer simulation of complex systems and processes. ... https://cs.msu.ru/node/1707 . ... 2008?2016 ASR Department , CMC Faculty , Lomonosov MSU . ...

Еще в разделе: (Показать все результаты (>12) - ani.cmc.msu.ru/ )

... To exchange messages with server and other clients special window - Chat - should be opened. ... In the Connected Clients field of the Chat window all clients connected to the server are shown. In a Dialog history all messages you've send or received are displayed. The third field is used to write a message (send message field). ... If you want to send your message to some clients select them in Connected Clients field with a help of a mouse CTRL and Shift buttons, than press Enter. ...

Еще в разделе: (Показать все результаты (>126) - www.spm.genebee.msu.ru/ )

• Fast probe landing and retraction
• Differential filters
• Data Processing Functions (Mathematics Menu)

... Fast Facts about the Faculty of Journalism . ... Academic Departments . ... Partners . ... All partners . ... Fast facts . ... Full-time faculty: 225 (170 lecturers including professorship, 55 researchers) љљ . Student-to-faculty ratio: approximately 1:11 љ . ... Academic departments: . ... Learn more about the Faculty of Journalism in the attached brochure . 1999-2014 Faculty of Journalism, Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>30) - www.journ.msu.ru/ )

On-line Data . COHO data . ... PIONEER 10 . ... PIONEER VENUS ORBITER . OMNI data . OMNI Data Set . LASRE data . CORONAS-I (electrons) . ... COSMOS 1686 (electrons) . ... Magnetopause Crossings Data . ... Data format description can be found here . Data are available from Feb. 1, 1986 till Dec. ... Day of the Month(DD): . Month of the Year(MM): . Year(YYYY): . ... Electron fluxes (E e 0.1 MeV) . ... Electron fluxes (E e 40 keV) . ... Electron fluxes (0.3 e . ...

Еще в разделе: (Показать все результаты (>21) - dbserv.sinp.msu.ru/ )

• Proton Online Data Set Selector
• Electrons Online Data Set Selector
• OMNI Online Data Set Selector

Division Information . ... Site Information . ... Analytical Chemistry Division at the Department of Chemistry, M. V. Lomonosov Moscow State University is the leading Russian center in analytical science and education . ... Division comprises of 5 research laboratories and education lab facilities. ... Postal address: Analytical Chemistry Division, Department of Chemistry, Lomonosov Moscow State University, Leninskie Gory 1, 119899 Moscow, Russia . ... Chemistry Department of Moscow State Univesity . ...

Еще в разделе: (Показать все результаты (>23) - analyt.chem.msu.ru/ )

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ­ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ­ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.ru/pages/pdf/nar2004.pdf
• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2002_1.pdf

... Erythrocyte and plasma protein modification in alcoholism: a possible role of acetaldehyde. ... Analysis of the oxidative modification of plasma and erythrocyte ghost proteins of chronic alcoholic subjects and healthy non-alcoholics has been performed. It was found that increased levels of protein carbonyls in both plasma and erythrocyte ghosts from alcoholic subjects occurred in comparison to the levels found in preparations from non-alcoholics. ...

Еще в разделе: (Показать все результаты (>55) - biochem.bio.msu.ru/ )

• Biochemistry Department of Moscow State University | Na,K-ATPase and its role

LOCAL TSUNAMI WARNING AND MITIGATION ________________________________________________________________________________________________________________________________________ THE NEW GRIDDED KURIL-KAMCHATKA BATHYMETRY FOR TSUNAMI MODELING An. ... For calculations in each grid point where the depth is to be found the algorithm uses up to 9 points from data source. ... Then the spline interpolation is used for defining the depth value in the grid-point. ... Hydrographic Survey Data, CD-ROM data set, Ver. ...

Еще в разделе: (Показать все результаты (>26) - seac47-2.phys.msu.ru/ )

• LOCAL TSUNAMI WARNING AND MITIGATION -- Official information
• LOCAL TSUNAMI WARNING AND MITIGATION

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

HOTEL ACCOMMODATION IN MOSCOW We are glad to offer the accommodation for the conference participants in the following hotels. ... Breakfast: buffet table Price: Single room ­ 120 euro Single room comfort ­ 130 euro Double room ­ 140 euro Check-in 12:00, check-out 12:00 DEADLINE for booking and making payment is 1 May 2007 HOTEL Holiday Inn Lesnaya 4**** Address: Moscow, Lesnaya st., 15 Location: The Holiday Inn Moscow Lesnaya hotel is ideally located for both the business and leisure travelers. ...

Еще в разделе: (Показать все результаты (>91) - www.enzyme.chem.msu.ru/ )

• http://www.enzyme.chem.msu.ru/ryabov/pdf/ICA_00.pdf
• http://www.enzyme.chem.msu.ru/bc2007/Hotel_accommodation_in_St_Petersburg.pdf
• http://www.enzyme.chem.msu.ru/ryabov/pdf/JOM_99.pdf

... This applet generates an observing list based on an observer's location and time. ... To use this program, enter in your location, and the local times at which you wish to begin and end observing. The date you enter should correspond to the calendar day at the time at which you begin observing. For example, if you wish to observe from 9:37 PM October 23, 2007 until 3:21 AM October 24, 2007, you would enter 21:37 for the starting time, 03:21 for the finish time, and 10/23/2007 for the date. ...

Еще в разделе: (Показать все результаты (>24) - observ.pereplet.ru/ )

... 216 (2003) 209^219]C Sarah Aciego a;b ; Г , B.M. Kennedy a , Donald J. DePaolo John N. Christensen a , Ian Hutcheon c a b c a;b , Earth Sciences Division, E.O. Lawrence Berkeley National Laboratory, Berkeley, CA 94720, USA Department of Earth and Planetary Science, University of California, Berkeley, CA 94720-4767, USA Analytical and Nuclear Chemistry Division, Lawrence Livermore National Laboratory, P.O. Box 808, Livermore, CA 94551-0808, USA In the above article there were typographic errors in Eq...

Еще в разделе: (Показать все результаты (>78) - hbar.phys.msu.ru/ )

• http://hbar.phys.msu.ru/gorm/ahist/antikythera3.pdf
• http://hbar.phys.msu.ru/gorm/ahist/antikythera4.pdf
• http://hbar.phys.msu.ru/gorm/ahist/antikythera2.pdf

. Posted by damilare sanuade 14 Oct 2004 23:27:56 . Hello, i just want to know when the form will be out.i wish to know when the form for degree programmes with out for sales just because i need the form and i want to come to ur school. i will like when the form will end too so that i can know when i will collect it.i wish to know the location where i can get the form around Ibadan(oyo state). Last Damola Sanuade 09/7/2007 ( 1) . WHERE ARE YOU SANUADE 11/9/2007 ( 0) .

Еще в разделе: (Показать все результаты (>481) - www.fadr.msu.ru/ )

• Jennifer Abel COMMENTS ON PAPERS
• Foundation for Agrarian Development Research - Services - Portfolio
• Фотоархив "EcoPhoto" - Order images - Posters