... For the past years I have been working on the problem of synthesis of light curves of close binary systems, consisting of a normal star and a compact object (point object with fixed X-ray luminosity). ... Possible existence of a bright spot on the disk's lateral surface is taken into account. ... The last of then will be published in Gordon and Breach Publishers ( Cherepashchuk A.M., Katysheva N.A., Khruzina T.S., Shugarov S.Yu. ... Cherepashchuk A.M., Katysheva N.A., Khruzina T.S., Shugarov S.Yu. ...

Еще в разделе: (Показать все результаты (>12) - uranus.sai.msu.ru/ )

Proposals and projects in the Coordinated Call FP7-ICT-2011-EU- Russia Information Meeting Moscow: 21st October, 2010 EU- Russia Call · First ICT Joint Call with Russia (dedicated INCO Call in WP 11-12); joint calls have already been implemented in other areas of FP7 · Russia is investing in High Performance Computing: No 12 supercomputer in the top500 list is Russian; aiming to enter Top3 already in ...

Еще в разделе: (Показать все результаты (>42) - www.msu.ru/ )

• Web-сайты МГУ

... One can compare the positions of these singularities and their corresponding singular variables in the Feynman diagrams which contribute to the signal process under consideration, and to both reducible and irreducible backgrounds. ... For a standard analysis using cuts on variables, one should cut hard against the regions of singularities in the background singular variables while keeping the regions with singularities for the signal singular variables (see e.g. [8]). ...

Еще в разделе: (Показать все результаты (>9) - top.sinp.msu.ru/ )

Notice : Undefined index: idf in W:\Apache\wwwEnzyme\efremenko\ref.php on line 19 . Notice : Undefined variable: File in W:\Apache\wwwEnzyme\efremenko\ref.php on line 70 . ... Warning : fclose(): supplied argument is not a valid stream resource in W:\Apache\wwwEnzyme\efremenko\ref.php on line 72 . Laboratory of Ecobiocatalysis . ... Head of the laboratory: Ph.D., D.Sc., prof. Efremenko Elena N. Affiliation and official address: . ... E-mail: efremenko@enzyme.chem.msu.ru . ...

Еще в разделе: (Показать все результаты (>100) - www.enzyme.chem.msu.ru/ )

... Labour recruiting policy and the Nobel Association of Oil Producers. A Set of Dbase Language Programs for Studying Social Dynamics . ... Our work was based on the personnel files of 2000 workers of the "Nobel Association of Oil Producers" (Garskova and Akhanchi 1993; see also Garskova and Akhanchi 1994). ... A set of dBase language programs . ... For this purpose a package of dBASE IV language programs has been created. ... The largest group of Nobel Brothers workers was Russians. ...

Еще в разделе: (Показать все результаты (>88) - hist.msu.ru/ )

• High-Level Decision Making in the Soviet Administrative-Command Economy
• Corporate Social Policy as an Approach to Managing the Workforce: Some Examples
• Discrimination and the Labor Market in the Oil Industry in Baku

... The "diagrams of minimum expected tsunami arrival time" are shown for 25 coastal sites; the TWS dead zones for each of these sites are distinguished by more frequent isolines (every 1 min). ... I ( is the site name). ... We presented isolines of minimum expected tsunami time for all these sites. ... However, there are also sites, In every such case the minimum expected tsunami time tmin has to be to the minimum tsunami propagation time at the distance R in the direction to the respective settlement....

Еще в разделе: (Показать все результаты (>21) - seac47-2.phys.msu.ru/ )

• http://seac47-2.phys.msu.ru/proc/E22_Watts.pdf
• http://seac47-2.phys.msu.ru/proc/E01_Armigliato.pdf

Core information (Nucleus, Levels, Gamma transition, Decays, Data type) . ... any adopted (levels and gammas only) experimental . ... Query parameters: . Select for output . ... Levels (E, JPI, T1/2, etc.) ... Energy (keV) . ... Y D H M S MS US NS PS FS AS EV KEV MEV or Stable . ... Energy of the ?-ray (keV) . Relative photon intensity . ... Energy parameters of nucleus (B , Alpha energy, N, P separation energy) . ... Neutron separation energy (keV) . Proton separation energy (keV) . ...

Еще в разделе: (Показать все результаты (>3) - depni.sinp.msu.ru/ )

ROBUST REGRESSION METHODS FOR ASSET ALLOCATION MODELING Shchetinin Eu.Yu., ... 1 Many strategies for asset allocation involve the computation of expected returns and covariance or correlation matrix of financial instruments returns. ... The expected returns and the covariance matrix contain many parameters to estimate and two main problem s arise. First, the data will very likely have outliers that will seriously affect the covariance matrix. ...

Еще в разделе: (Показать все результаты (>144) - www.mce.biophys.msu.ru/ )

• http://www.mce.biophys.msu.ru/archive/doc27504/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc144724/eng.pdf
• http://www.mce.biophys.msu.ru/archive/doc27212/eng.pdf

... Advanced chapters of operation research . Algebraic characterization of basic solution of linear program. ... Advanced chapters of Actuarial Mathematics . ... Discounted cash flow analysis and capital budgeting as decision tools are given particular emphasis. ... In the first part of the course we present a modern approach to modeling economic systems. ... The problem of tax optimization under a given financing budget. ... Магистратура: master@cmc.msu.ru, 3-й этаж, комната 360, тел. ...

Еще в разделе: (Показать все результаты (>8) - hcs.cmc.msu.ru/ )

... Parasitized females still produce eggs, but because juvenile development occurs inside the female marsupial brood pouch, young gammarids experience the same risk of predation as their mother until they exit the marsupium. ... Contrary to our expectation, we observed the opposite result, that is, juveniles from parasitized females exited the marsupial brood pouch significantly later than did those from uninfected ones. ... Females were kept if both partners were infected. ...

Еще в разделе: (Показать все результаты (>23) - ecology.genebee.msu.ru/ )

• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2004_Birthweight_JEvolBio.pdf
• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2003_Envir_human_EER.pdf
• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/1999_Seasons_EER.pdf

NMW survey overview . Access image archive . ... The New Milky Way survey aims to detect bright (V<13.5) optical transients near the Galactic plane using an automated wide-field (8x6 deg.) system capable of surveying the whole Milky Way area visible from the observing site in one night. ... All images obtained during the transient search survey are available online (please use the image archive access form ). ... Images per field: . ... Images per night: . ... Milky Way imaging time: . ...

Еще в разделе: (Показать все результаты (>3) - scan.sai.msu.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... Here we provide some instructions that will allow you to make your own visualization using powerful abilities of PyMol. Below you can find step-by-step instruction of how to visualize partial charges or other atomic information. ... Partial charge? All charges will appear near all atoms! ... Нет комментариев " Visualize partial charges in PyMol " . ... Visualize partial charges in PyMol . ... 2014 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>29) - erg.biophys.msu.ru/ )

• Gaussian Cube files loader ERG Research Group: Лаборатория теоретической
• Peter Mamonov ERG Research Group: Лаборатория теоретической биофизики
• Normal modes visualization for PyMol ERG Research Group: Лаборатория

... Two-dimension linear regression model. ... The econometric modeling of time series . ... The course aims to provide students with basic models and methods of econometric modeling of financial time series. ... The course considers in detail the major methods of econometric modeling of time series, in particular modeling by stochastic processes, modeling of stationary and non-stationary time series, the spectrum analysis of time series. ... The problem of tax optimization under a given state budget. ...

Еще в разделе: (Показать все результаты (>5) - io.cmc.msu.ru/ )

... Reports on progress and error are always recorded in the log file of the program. ... UT date of the measurement finish in YYYY-MM-DD format UT time of the measurement finish in hh:mm:ss format Average flux in A aperture Average flux in B aperture Average flux in C aperture Average flux in D aperture Normalized variance of flux in A aperture Normalized variance of flux in B aperture Normalized variance of flux in C aperture Normalized variance of flux in D ...

Еще в разделе: (Показать все результаты (>22) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/sv_ug.pdf
• http://curl.sai.msu.ru/mass/download/doc/rcx_advices.pdf

... The data on UV glow of the atmosphere obtained in operation of one pixel of the TUS detector on board the Moscow State University "Universitetsky-Tatiana" satellite was taken into account in design of the updated TUS detector. ... The main feature of the design is use of MEMS technology scanning mirror controlled by the TUS computer, analyzing the recorded EAS data and directing the laser to the atmosphere spot, where back scattered Cherenkov light came from. ... Monitoring of UV intensity on-route....

Еще в разделе: (Показать все результаты (>3) - cosrad.sinp.msu.ru/ )

• http://cosrad.sinp.msu.ru/experiments/tus/doc/Ponce2007fin.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>7) - storage.bioinf.fbb.msu.ru/ )