Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Feldstein Y.I. , Vorobjev G.V. , Leontyev S.V. , Elphinstone R.D. , Alexeev I.I. , Belenkaya E.S. в сборнике The 19yh Annual European Meeting on Atmospheric Studies by Optical Methods , место издания Kiruna, Sweden , с. 123-141 . ...

Еще в разделе: (Показать все результаты (>3945) - istina.msu.ru/ )

• Shakina Y.N. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Klochkov A.A. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Gaister A.V. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

Electron and proton impact ionization of atoms and molecules . Theory of few-body Coulomb scattering This is one of the major topics in the research activity of our laboratory. ... Electron momentum spectroscopy (EMS) EMS is the (e,2e) method involving high incident energy and large momentum transfer. ... We develop a theory of the single- and double-ionization EMS processes in atomic and molecular systems. ... c) Laboratory of mathematical models of quantum scattering processes, 2012 . ...

Еще в разделе: (Показать все результаты (>9) - lmmqsp.sinp.msu.ru/ )

... 2 1 2 (2008) 5­9 available at www.sciencedirect.com journal homepage: www.elsevier.com/locate/ecolmodel The impact of different density stresses on the dynamics of two competitive populations Anatoly T. Teriokhin , Elena V. Budilova Department of Biology, Moscow Lomonosov State University, Moscow 119992, Russia article Article history: info abstract We compare the asymptotic dynamics of two competitive populations described by a ... Second, only the density of youngs can be reduced. ...

Еще в разделе: (Показать все результаты (>36) - ecology.genebee.msu.ru/ )

• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2002_Host_manip_IJP.pdf
• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2004_Birthweight_JEvolBio.pdf
• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/1999_Seasons_EER.pdf

... The field of the fast first pulse is mainly localized within low refractive index layers, whereas the slow second pulse field is mostly in high refractive index layers. ... In the PC, each spectral component of a pulse incident at the Bragg angle with respect to the PC layers splits up into a coherent superposition of two transmitted and two diffracted diffractively reflected waves. ... The first pulse is formed by the waves E01 and Eh1, whereas the second one is formed by waves E02 and Eh2. ...

Еще в разделе: (Показать все результаты (>62) - genphys.phys.msu.su/ )

• http://genphys.phys.msu.su/rus/sci/photonics/PDF/JETP56.pdf
• http://genphys.phys.msu.su/rus/sci/photonics/PDF/10.pdf
• http://genphys.phys.msu.su/rus/sci/photonics/PDF/5.pdf

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>187) - www.genebee.msu.ru/ )

• DIMACS Series in Discrete Mathematics and Theoretical Computer Science Volume
• BioSystems, 30 (1993) 57-63 57
• Impact Factors of Scientific Journals in 1999

... The factors that play the key role in complex formation are as follows: the rate of protein diffusion to the docking site; long-range electrostatic interactions between protein surfaces, geometric and chemical complementarity of binding areas; molecular mobility at the protein­protein interphase, hydrogen bonds, Van der Waals interactions, hydrophobic interactions, and salt bridges. ... Three-dimensional protein molecules are constructed on the basis of data extracted from the Protein Data Bank. ...

Еще в разделе: (Показать все результаты (>51) - www.library.biophys.msu.ru/ )

• http://www.library.biophys.msu.ru/PDF/80521.pdf
• Fluorescence induction curves registered from individual microalgae cenobiums
• МОДЕЛИРОВАНИЕ ВЗАИМОДЕЙСТВИЯ МАГНИТНОГО ПОЛЯ С ОБЪЕМНЫМИ ВЯЗАНЫМИ СТРУКТУРАМИ

I NSTITUTE OF PHYSICS PUBLISHING PHYSICAL B IOLOGY Phys. Biol. 3 (2006) 121­129 doi:10.1088/1478-3975/3/2/004 Direct simulation of plastocyanin and cytochrome f interactions in solution I B Kovalenko1,AMAbaturova1, P A Gromov2,DMUstinin1, E A Grachev2, G Yu Riznichenko1 and ABRubin1 1 2 ... 2006 Online at stacks.iop.org/PhysBio/3/121 Abstract Most biological functions, including photosynthetic activity, are mediated by protein interactions ... We use this structure in our simulation. ...

Еще в разделе: (Показать все результаты (>37) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3329.pdf
• http://library.biophys.msu.ru/PDF/3343.pdf
• http://library.biophys.msu.ru/PDF/3335.pdf

Appl Phys B DOI 10.1007/s00340-010-4081-z Multifilamentation of high-power femtosecond laser pulse in turbulent atmosphere with aerosol E.P. Silaeva · S.A. Shlenov · V.P. Kandidov Received: 18 February 2010 / Revised version: 29 April 2010 © Springer-Verlag 2010 Abstract The filamentation of a femtosecond laser pulse in atmosphere under the joint influence of turbulence and aerosol has been numerically studied for the first time. ... Strong turbulence can inhibit the pulse filamentation process. ...

Еще в разделе: (Показать все результаты (>105) - ilc.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/upload/iblock/588/y2l.pdf
• Grant detail
• Грант подробно

... initial value of E in linear potential sweep voltammetry), was derived for reversible reaction O + ne R proceeding in a compact film adsorbed onto an electrode of surface A. A series of inferences from this equation, namely: (1) the appearance of peak current ip at potential value E = Ep (i.e. = 1); (2) the equality of adsorption densities of reduced (R) and oxidized forms (O) to each ... Case II: reaction on the film physical border (including lateral surface of pores). ...

Еще в разделе: (Показать все результаты (>22) - www.elch.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/mole/lecture/probst.pdf
• http://www.elch.chem.msu.ru/mole/lecture/qprice.pdf

darkhan@105 : GNU GENERAL PUBLIC LICENSE darkhan@105 : Version 2, June 1991 darkhan@105 : darkhan@105 : Copyright (C) 1989, 1991 Free Software Foundation, Inc., darkhan@105 : 51 Franklin Street, Fifth Floor, Boston, MA 02110-1301 USA darkhan@105 : Everyone is permitted to copy and distribute verbatim copies darkhan@105 : of this license document, but changing it is not allowed. darkhan@105 : ... You are not required to accept this License, since you have not darkhan@105: signed it. ...

Еще в разделе: (Показать все результаты (>10458) - kodomo.fbb.msu.ru/ )

• cca: ef8839e99f34 COPYING
• cca: 1ff4d543476f COPYING
• cca: 73d577b8cfaa COPYING

... Выпускники . ... Женский клуб . ... Издательство МГУ . ... The correct theoretical analysis of the generally accepted foundations of theoretical physics is proposed. ... The main result is as follows: the foundations (i.e. classical thermodynamics, the special theory of relativity, quantum mechanics) contain logical errors The existence of logical errors is irrefutable proof of incorrectness of the theoretical foundations and means that theoretical physics enters the greatest crisis. ...

Еще в разделе: (Показать все результаты (>317) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Таблетка-чип, заменяющая врача. умная таблетка, smart...

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>356) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 2/2011

... The shape of the spectra and the angular distributions of photoelectrons are considered in the near-threshold region for the case of photoelectron­Auger electron coincidence experiments as well as for noncoincidence measurements. ... For the case of innershell photoionization and the following Auger decay, we consider the triple differential cross section TDCS which is differential with respect to the energies of the both emitted electrons and the angle of the photoelectron emission. ... Phys. Usp. ...

Еще в разделе: (Показать все результаты (>111) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/LIIWM/PhysRevA62_2000_022718NMKab.pdf
• http://danp.sinp.msu.ru/LIIWM/JPhysB_40_3413_07KabachKazanski.pdf
• http://danp.sinp.msu.ru/Articles_GSIB/nimb_sputteryield_sizeclasterion.pdf

... Formulation of the problem ­ angle about the mass center C IC = mR 2 ­ central moment of inertia m and R ­ mass and radius of the hula-hoop k ­ coefficient of viscous friction r ­ radius of the waist FT ­ friction force N ­ reaction force ­ angle between x and CO x = a sin t , IC m m Ё +k (R - (R - y = b cos t = -FT R r ) = m (x sin + y cos ) + FT Ё Ё Ё r ) 2 = m (x cos - y sin ) + N Ё Ё (R - r ) = R ­ non-slippage where constants 0 mod 2 are defined from + µ cos 0 = 0. ...

Еще в разделе: (Показать все результаты (>12) - belyakov.imec.msu.ru/ )

• http://belyakov.imec.msu.ru/papers/Belyakov_eng.pdf
• http://belyakov.imec.msu.ru/papers/Belyakov_Seyranian_6pages2011.pdf
• http://belyakov.imec.msu.ru/papers/PhysCon2005.pdf

... Electronic journal Issue 4. 10 september 2004 Briedis V. Pareto Structures A great Italian economist Vilfredo Pareto (1848 ­ 1923) in his unique economics and sociology studies [1, 2] continuously emphasised the systematic approach, reviewing the society development problems. ... Formal model of Pareto Structure First of all, provide a formal mathematical model adequately featuring the Pareto Structure. ... Indeed, I was primarily interested in the classical (harmonic structure) model at s = 1. ...

Еще в разделе: (Показать все результаты (>7) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./nekipelov.pdf

... Студенческая Астрономическая обсерватория ГАИШ . ... Структура ГАИШ : Отдел внегалактической астрономии : . ... For those really interested in galaxies, extragalactic astronomy or the aspects of cosmology we study, we can always find an interesting problem to work on. ... To make your work in the Group most effective, it would be useful to study the following courses read by our group members as well as the members of other groups in our and other institures. ... Student information . ...

Еще в разделе: (Показать все результаты (>31) - www.sai.msu.ru/ )

Disjoining pressure of an electrolyte film confined between semipermeable membranes Salim R. Maduar and Olga I. Vinogradova Citation: The Journal of Chemical Physics 141, 074902 (2014); doi: 10.1063/1.4892758 View online: http://dx.doi.org/10.1063/1.4892758 View Table of Contents: http://scitation.aip.org/content/aip/journal/jcp/141/7?ver=pdfcov Published by the AIP Publishing Articles you may be interested in Order of wetting transitions in electrolyte solutions J. Chem. ... Chem.- ... Phys. Commun. ...

Еще в разделе: (Показать все результаты (>40) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/paper/JCP2014.pdf
• http://nanofluidics.phys.msu.ru/paper/jcp2012_1.pdf
• http://nanofluidics.phys.msu.ru/paper/vinogradova-lobaskin-2012.pdf

... Distribution of neutron counting rate near the Earth surface is studied in two directions - to the Earth and from it - according experimental data, obtained in Moscow in 1996. ... We suppose that logarithmically normal distribution describes an input of the Earth crust into the neutron flux. ... Usual periods . ... Full approximation of thermal neutrons distribution near the Earth crust is presented as a sum of two functions - Poison distribution and logarithmically normal distribution. ...

Еще в разделе: (Показать все результаты (>261) - www.kosmofizika.ru/ )

Twilight observations with MASS/DIMM B. Safonov Sternberg Astronomical Institute Moscow State University Comprehensive Characterization of Astronomical Sites, 2010 B. Safonov (Moscow State University) Twilight observations with MASS/DIMM SITE 2010 1 / 17 Why observe in twilight with MASS/DIMM? ... ASM includes 3 devices sensitive to background: guider, DIMM and MASS. B. Safonov (Moscow State University) Twilight observations with MASS/DIMM SITE 2010 2 / 17 Background in guider. ...

Еще в разделе: (Показать все результаты (>24) - site2010.sai.msu.ru/ )

• http://site2010.sai.msu.ru/static/doc/VNosov_site2010.pdf
• http://site2010.sai.msu.ru/static/doc/Site2010-Summary.pdf
• http://site2010.sai.msu.ru/static/doc/TTravouillon_TMT_site_testing_site2010.pdf

The quantitative probabilistic model of the solar energetic particle fluxes description by R.A.Nymmik from Skobeltsyn Institute of Nuclear Physics, Lomonosov Moscow State University, 119991, Moscow, Russian Federation, nymmik@sinp.msu.ru Abstract The description of a quantitative probabilistic model for peak fluxes and fluences of solar energetic particles from protons up to Ni ions is presented. ... Nymmik R.A. Probabilistic model for fluences and peak fluxes of solar energetic particles, Rad. ...

Еще в разделе: (Показать все результаты (>35) - smdc.sinp.msu.ru/ )

• APEV service - Space monitoring data center
• Scientific services - Space monitoring data center
• Spatial distributions of particles (based on data from Coronas-F and