О лаборатории . ... Лаборатория теоретической биофизики . ... System requirements : python 2 (2.6 and higher), python openbabel library, python numpy library. ... The memgen script makes a bilayer membrane from different phospholipids and other lipid compounds (e.g. cholesterol). ... Biochemistry (Moscow) Supplement Series A: Membrane and Cell Biology, 2011, Vol. ... Нет комментариев " Python membrane generator for MD simulations " . ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>34) - erg.biophys.msu.ru/ )

• Python script for processing FRAP image set ERG Research Group: Лаборатория
• Gaussian Cube files loader ERG Research Group: Лаборатория теоретической
• PyMol script for scanning potential energy surfaces ERG Research Group:

... The external forces is [0,T ], the alge"practical" work forces) is in fact the sum (for all For a control force or torque u and a motion T braic work of external forces is W = udx = 0 u of external forces (i.e. the energy spent via the T |ux|dt. ... Our theory is twofold: 1. ... With the Maximum Principle, assuming the minimization of a criterion which is a compromise b etween the absolute work and some other term (comfort term), we prove that inactivations must appear. ...

Еще в разделе: (Показать все результаты (>3) - pont2008.cmc.msu.ru/ )

... Без указания автора . Ordinations // Вестник Русского Западно-Европейского Патриаршего Экзархата . ... 56 (ВРЗЕПЭ) . ... Ключевые слова: официальная часть . ... Osoline Nicolas, diacre, t ordonn pr tre // Вестник Русского Западно-Европейского Патриаршего Экзархата . ... Pace, Eusebio, pr tre, a t frapp de d position // Вестник Русского Западно-Европейского Патриаршего Экзархата . ... Ключевые слова: периодика: "Вестник Русского Западно-Европейского Патриаршего Экзархата" См. дальше ...

Еще в разделе: (Показать все результаты (>10) - www.srcc.msu.ru/ )

• http://www.srcc.msu.ru/bib_roc/bib/ItemsJ62.htm

... Letter of Application . ... Minilecture: How to organise information in the letter of application. When one applies for a position in a company, the letter of application cannot and should not contain all the information a prospective employer wants to know about you. ... If you know about a job opening within the company, refer directly to that position; if some person from that company told you of the job opening, you may begin the first paragraph by mentioning this person by name. ...

Еще в разделе: (Показать все результаты (>3) - anazarenko.ffl.msu.ru/ )

S.S. Faustov, E.I. Virina, A.I. Tsaskin, T.S. Gendler F. Heller The Matuyama/Brunhes boundary in loess sections in the south of the East European Plain and their correlation on the basis of paleomagnetic and paleopedologic data // Quaternary International, 2009, V. 201. ... Abstract The Matuyama/Brunhes boundary (MBB) in loess sections of the East European Plain, one of the greatest areas of global loess distribution, is a highly debatable issue. ...

Еще в разделе: (Показать все результаты (>118) - www.geogr.msu.ru/ )

• CONTENTS ?1 - 2009
• CONTENTS ? 2 - 2012
• CONTENTS ? 1 - 2013

... Alexander A. Moskovsky . ... Software Designer : . ... Projects: . Janitor II, Custodian III for Matrix Logic - utilities for DOCS Open EDMS (electronic document management system), C++/Win32 platform. ~2 man-year project with 5 persons team. iBuzz - (for ibuzz.com ) large client-server system (Win32, Enterprize Java Beans, Oracle, Sun/Solaris). ... Lunch Ordering Web System. ... Software Resources International , former Digital Moscow Software Center, . ... Physical Chemistry chair, . ...

Еще в разделе: (Показать все результаты (>8) - lcc.chem.msu.ru/ )

• People
• Current Projects

... Academician of RAS, Professor . Algebraic topology, integrable systems . ... Docent, PhD . alania at mech.math.msu.su . Algebraic topology, low-dimensional topology . ... Dr. of Science, PhD . ... Algebraic topology . ... Algebraic topology, integrable systems, combinatorics . ... Low-dimensional topology, integrable systems . ... Algebraic topology, combinatorics . ... Integrable systems . ... Algebraic topology, topology of manifolds, combinatorics . ... Geometry, integrable systems . ...

Еще в разделе: (Показать все результаты (>78) - higeom.math.msu.su/ )

• english
• Bookmarks for asmish
• INVITED ADDRESSES:

... Time as phenomenon of the expanding Universe . ... Laboratory-chair "Time as a phenomenon of the Universe expansion" . ... Absolute Time . ... An evolution of a material particle position on a hypersurface during the Universe expansion while its world line is direct and inclined at some angle to a radius. ... An evolution of a material particle position on a hypersurface during the Universe expansion while its world line is not direct and inclined at variable (at different time) angle to a radius. ...

Еще в разделе: (Показать все результаты (>229) - chronos.msu.ru/ )

• Pic. 3.

Next: Numeric Capabilities Up: 8.2.4 Termcap Capabilities Previous: 8.2.4 Termcap Capabilities . 5i Printer will not echo on screen . am Automatic margins which means automatic line wrap . ... da Display retained above screen . ... eo A space erases all characters at cursor position . ... hc This is a hardcopy terminal . ... mi Cursor movement works in insert mode . ms Cursor movement works in standout/underline mode . ... xt Teleray glitch, destructive tabs and odd standout mode . ...

Еще в разделе: (Показать все результаты (>82) - itpm.msu.su/ )

• Forcing Mail into Misconfigured Remote Sites
• Converting Modules from Apache 1.3 to Apache 2.0 - Apache HTTP Server
• Tables in HTML documents

Вы посетили: englver.html . ... История кафедры . ... Mailing address: Faculty of Algebra, Department of Mathematics and Mechanics, Moscow State University, 119991, GSP-1, Russia, Moscow . E-mail address: guterman at list dot ru . ... Position: Professor at the Moscow State University, Faculty of Algebra, Department of Mathematics and Mechanics . ... Recent invited addresses . ... staff/guterman/englver.html.txt Последние изменения: 13.02.2013 11:26 (внешнее изменение) | ...

Еще в разделе: (Показать все результаты (>10) - halgebra.math.msu.su/ )

... THE LJUBLJANA SUMMER SCHOOL 2006 . ... THE LJUBLJANA SUMMER SCHOOL 2006 is a new intensive programme open to both undergraduate and graduate students of Business, Economics, and other fields of Social Sciences. The programme was created at the Faculty of Economics in Ljubljana in order to impart knowledge by taking full advantage of our country s unique geographical position: the meeting point of East and West. ... The Summer School s aim is to learn by applying knowledge to real-life situations. ...

Еще в разделе: (Показать все результаты (>23) - www.mgubs.ru/ )

... Laboratories: . Inorganic Materials Sciences . ... Inorganic Synthesis . Inorganic Crystallochemistry . Laboratory people: . ... Al yo shin V ladimir A. Assoc . Prof . Dr. Sci . ... 7(495)939-1200 . Ardashnikova E lena I. Assoc . ... Ph.D . ... 7(495)939-5502 . ... Vice Head of the division . ... Assoc . ... Assist Prof. Ph.D . ... Vice Head of the division, Vice head of the laboratory . ... Shevelkov Andrei V. Professor, Head of the division, Head of the laboratory , . ...

Еще в разделе: (Показать все результаты (>20) - www.inorg.chem.msu.ru/ )

• Inorganic Chemistry Division
• Joint Semiconductors Surface Study group
• Staff listing - Inorganic Chemistry Division - Chemistry Department - Lomonosov

... Explaining Basic Menzerathian Regularity: Dependence of Affixes' Length on the Ordinal Number of their Positions within Words . Chronological Morphemic and Word-Formational Dictionary of Russian: Some System Regularities for Morphemic Structures and Units . Menzerath's Law for Morphemic Structures of Words: A Hypothesis for the Evolutionary Mechanism of its Arising and its Testing. An abstract of a paper submitted for the 4th International Conference on Quantitative Linguistics. ...

Еще в разделе: (Показать все результаты (>38) - old.philol.msu.ru/ )

• MSU-LGCLL:: Krylov J.K. - On the Nature of Koehler's Effect
• MSU - Laboratory for General and Computational Lexicology and Lexicography
• MSU-LGCLL:: Curriculum Vitae of Anatoliy Anatolyevich Polikarpov

To make visas please contact Olga I. Yakovenko . ... Date of birth: . ... Date of issue: . Date of expiration (your passports must be valid 3 months after the end of the sojourn in Russia): . ... Date of arrival in Russia: . Date of leaving Russia: . Single or multiple visa: . ... Location of the consulate where you will obtain the visa*: *) You are not obliged to come in the central Russian Consulate in your country for obtaining your visa. ... Visas to Russia . ... Information . ...

Еще в разделе: (Показать все результаты (>16) - seac47-2.phys.msu.ru/ )

... Each year about 25 new students (3rd year of education) who want to have special education not only in chemistry but also in life sciences join our department. ... They can choose one of two specializations: Physical Chemistry of Enzymes or Enzyme (Protein) Engineering. ... There is a new lecture course for all students studying at the Faculty of Chemistry concerning Chemical outlook to life sciences given by Prof. S.D.Varfolomeev. ... Enzyme kinetics (4th year of education) (Prof. A.V.Levashov). ...

Еще в разделе: (Показать все результаты (>101) - www.enzyme.chem.msu.ru/ )

• Personal page of professor Vladimir Tishkov
• Research Group of Biochemistry of Fibrinolysis"
• Members of Genetic and Protein Engineering Group

VISA SUPPORT FORM | | |Date of arrival to Russia | | |Date of departure from Russia | | |Last name | | |First name | | |Gender | | |Citizenship | | |Country of Birth | | |Place of birth | | |Country of residence | | |Region of residence | | |City where visa will be issued | | |Affiliation | | |Business address | | |Position | | |Passport series | | |Passport number | | |Date of passport issue | | |Date of passport expiration | |

Еще в разделе: (Показать все результаты (>80) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/ihss-14/docs/regform-ihss14.doc
• List of participants

... Data . ... Models . Solar energetic particles . ... Neutron flux variations (RU) . ... This software computes omnidirectional, integral, or differential (in energy) fluxes of electrons and protons trapped in Earth's radiation belts for specified energy, L-value, and B/B0 range. The fluxes are obtained by an interpolation procedure from the experimental data. ... MODEL - one of following integer numbers, flux model: . ... AE4MAX, electrons, solar maximum . AE4MIN, electrons, solar minimum . ...

Еще в разделе: (Показать все результаты (>27) - smdc.sinp.msu.ru/ )

• APEV service - Space monitoring data center
• Space monitoring data center

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/mol_biol_mosk_2006.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/genome_biol_evol_2014.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/batmas30.pdf

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>2) - www.pereplet.ru/ )

Moscow University ] [ Brain Research Group ] . ... Alexander Yu. Zhigalov Ph.D. in Psychophysiology, M.V.Lomonosov Moscow State University, Russia, 2009 . thesis: "A study of human EEG alpha activity dynamics in the brain computer interface loop" . advisor: Prof. A.Ya.Kaplan . ... Kaplan A.Ya., Zhigalov A.Yu. The dynamic of human EEG alpha-activity in the loop of brain - computer interface during trigger photo stimulation. ... In Russian) . ... Levichkina E.V., Zhigalov A.Yu. ...

Еще в разделе: (Показать все результаты (>38) - brain.bio.msu.ru/ )

• Change-point detection algorithm performance with real EEG