Charge and mass transfer across the metal -solution interface E. Gileadi School of Chemistry Tel-Aviv University, ISRAEL gileadi@post.tau.ac.il 1 Time-Resolved Kinetics · The idea of different time scales for electron transfer and solvent reorganization is inherent in the Marcus theory · The characteristic time for different processes is: Electron transfer Solvent reorganization 1 fs 1 ps (103 fs) Diffusion across the ... Ag + soln +e crys Ag 0 soln E0 = - 2.55 V vs. ...

Еще в разделе: (Показать все результаты (>27) - electr003.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/bagotsky/interface2013.pdf

Providing GRID Data Services TODAY or: connect an existing data service fabric to a GRID DESY Patrick Fuhrmann, Martin Gasthuber Rich Wellner DESY /Hamburg Fermi DCache to GRID , DESY / Fermi ACAT 2002 June 24-28 Initial Remarks - We only talk about the data management, data access aspect of GRID computing - the 'Fabric' here is an existing ... GRID access protocols) - URL based access - no NFS mount required - dc_open("dcap://dcachedoor.desy.de/pnfs.desy.de/zeus/.. ...

Еще в разделе: (Показать все результаты (>26) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/26june.html

Home :: Cutting edge of the polymer science . ... RAS academician A.R. Khokhlov . ... E.F. Oleynik, scientific report Viscous deformation of glassy polymers. ... A.R. Khokhlov - General Information. ... A.R. Khokhlov - Scientific report: "Self-assembly in solutions of the amphiphilic polymers. ... A.R. Khokhlov - Scientific Report: "Polymers in supercritical carbon dioxide" . ... A.R. Khokhlov - General Information for Participants of the Seminar (Scientific News, Conferences, Grants) . ...

Еще в разделе: (Показать все результаты (>37) - polly.phys.msu.ru/ )

• Laboratory of nonlinear, non-equilibrium and complex systems

... Бережной А.А., Клумов Б.А., Фортов В.Е., Шевченко В.В. Письма в ЖЭТФ, Т. 63, N6, С. 387-391, 1996 . ... A. A. Berezhnoy1,2, N. Hasebe1, M. Kobayashi1, G. Michael3 and N. Yamashita1 1Advanced Research Institute for Science and Engineering, Waseda University, Tokyo, Japan 2Sternberg Astronomical Institute, Moscow, Russia 3German Aerospace Center, Institute for planetary research, Berlin, Germany . Brown University - Vernadsky Institute Microsymposium 40, 2004, Moscow, Russia . ...

Еще в разделе: (Показать все результаты (>32) - selena.sai.msu.ru/ )

• Aleksei A. Berezhnoi

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

... Prague , 2006 . ... The draft classification (version August 9, 2006 ) for new GCVS versions . Along with the "+" sign (coexistence of two types), it is suggested to introduce the "|" sign (meaning "or") - for classification options for the same object, e.g. EC|Ell, EC|RR. Pulsating variables . ... DCEP , DCEPS , CEP ( B ) DCep , DCep 0, DCep 1, DCepB 01, DCepB 12 . ... Eruptive variables . ... PN, WD, WR Remove from the classification, indicate through the spectral type or Remarks . ...

Еще в разделе: (Показать все результаты (>28) - sai.msu.ru/ )

• General Catalogue of Variable Stars: classification.
• Презентация PowerPoint

... Effect of colchicine on sensitivity of duck salt gland Na,K-ATPase to Na+. ... Low molecular mass proteins of the FXYD family that affect the sensitivity of Na,K-ATPase to Na+ and K+ are known to be present in Na,K-ATPases in various tissues. ... The goal of the present study was to reveal a low molecular mass protein (probably a member of FXYD family) in preparation of Na,K-ATPase from duck salt glands. ... Simultaneously, we observed a decrease in the sensitivity of Na,K-ATPase to Na+ at pH 6.5. ...

Еще в разделе: (Показать все результаты (>5) - biochem.bio.msu.ru/ )

• Neutral endopeptidase neprilysin is copurified with Na,K-ATPase from rabbit
• Biochemistry Department of Moscow State University | History
• Glutathionylation of the alpha-subunit of Na,K-ATPase from rat heart by

... Женский клуб . ... Издательство МГУ . ... Обсуждение статей и публикаций . ... МГУ им.Ломоносова . ... Выпускники МГУ . ... Дайв-Клуб МГУ . ... Хеллоуин содержит в себе элементы поклонения темным, сатанинским силам и, безусловно, является языческим праздником - рассказал дьякон домового храма мученицы Татианы при МГУ им. М.В. Ломоносова отец Александр Волков . ... Интересно, а в МГУ как-то праздник кануна всех святых отмечался? ...

Еще в разделе: (Показать все результаты (>39) - www.moscowuniversityclub.ru/ )

There are three foredeeps in the foreland of the Great Caucasus: West-Kubanian, East-Kubanian and Terek-Caspian, located in the back-side of the folded structures of the Great Caucasus. ... Lifted edge of the plate appeared divided on blocks like "piano keys". Simplified model: . The dynamic of each block is defined by the balance of gravity, restoring force, friction force from the nearby blocks and viscous resistance forces. ... To see the dynamic of the system (animated GIF-file, 285 Kb) . ...

Еще в разделе: (Показать все результаты (>8) - dynamo.geol.msu.ru/ )

• http://dynamo.geol.msu.ru/personal/vsz/papers/Zakharov_2013_2_eng.pdf

Laboratory of Microfluidics and Nanofluidics . Laboratory of Physical Chemistry of Modified Surfaces . ... Research . ... Laboratory of Micro- and Nanofluidics . ... Professor B.V.Derjaguin moved to the Laboratory with his research group as an Emeritus Professor. ... In 1993 Professor Olga I. Vinogradova took over the leadership of the Laboratory. In 2009 the Laboratory of Micro- and Nanofluidics was organized by Professor Olga I. Vinogradova at the Physics Department of the M.V.Lomonosov MSU. ...

Еще в разделе: (Показать все результаты (>27) - nanofluidics.phys.msu.ru/ )

Unitherm for Windows (version 4.5) Contents Unitherm for Windows compared to Unitherm for DOS 2 General comments 2 Limitations of Unitherm for Windows compared to Unitherm for DOS 2 Changes in Unitherm interface 2 New functionality of Unitherm for Windows 2 Specific features of Unitherm for Windows 3 Localization 3 Graphical user interface of Unitherm for Windows 4 The main ... mode. ... The window is opened with the List of reactions command of the Unitherm Reaction menu. ...

Еще в разделе: (Показать все результаты (>20) - www.geol.msu.ru/ )

Next Galleries . MSU HTSC 7. We are on the boat moving from Moscow to St. Petersburg. Next Galleries

Еще в разделе: (Показать все результаты (>12) - www.inorg.chem.msu.ru/ )

... All Authors Title Abstract Index terms Full Text . ... Home > ICONO/LAT 2016 > 2014 International Conference on Laser Applications in Life Sciences > About the Conference > Submissions . ... All URL addresses in the text (e.g., http://pkp.sfu.ca ) are activated and ready to click. ... If submitting to a peer-reviewed track of the conference, authors' names are removed from submission, with "Author" and year used in the bibliography and footnotes, instead of authors' name, paper title, etc. ...

Еще в разделе: (Показать все результаты (>6) - hea.phys.msu.su/ )

Laboratory of Informatics . Head of Laboratory E.S.Polischuk, senior researcher, DSc . ... research guidance of a four year student's project in the Faculty of Geography (N.M. Chernavskaya, DSc) . ... Grant of RFBF (Russian Foundation for Basic Research) 01-03-00332, the head of the project prof. R.B.Rybakov, Institute of Orientalistic (Russian Academy of Science), N. M. Chernavskaya - performer . ... N.M.Chernavskaya, DSc, senior researcher, T.B.Pleskacheva., DSc, senior researcher. ...

Еще в разделе: (Показать все результаты (>18) - srcc.msu.ru/ )

• Мортиков Е.В. Численное моделирование влияния стратификации на силу

... As a principal step for COD elimination, upflow anaerobic sludge bed reactor performance was investigated at 30°C. Under hydraulic retention times (HRTs) of about 1 d, when the organic loading rates were higher than 15g of COD / (L.d), the CODtot removal varied between 77 and 93%, giving effluents with a COD/N ratio of 4-5:1, approaching the requirements of subsequent denitrification. ... Coagulant addition Final Air emuent Air Influent /ntennediate reservoir Fig. ... Performance of UASB reactor. ...

Еще в разделе: (Показать все результаты (>50) - www.enzyme.chem.msu.ru/ )

• http://www.enzyme.chem.msu.ru/~tishkov/Publications/JBiotechnol_97_58_187.pdf
• http://www.enzyme.chem.msu.ru/ekbio/article/chem_bull.pdf
• products3

... An hour later, the satellite has proceeded to higher altitudes and the auroral proton precipitation pattern can be seen, using the SI-12 proton imager. ... The IMF dependence of the proton cusp signature has been described at length recently in several papers by Frey et al. [2002, 2003]. movie of this event This is just the first indication of activity and this storm is a continuing event, now with (a possibly unprecedented) 2 successive dips of DST below -300 nT. ... Proton aurora in the cusp . ...

Еще в разделе: (Показать все результаты (>187) - www.kosmofizika.ru/ )

Press release 20 July 2010 New opportunities for early-career top researchers from anywhere in the world: 661 Mio for new "ERC Starting Grant" call The European Research Council (ERC) announces its fourth call for proposals for the "ERC Starting Grants", open to early-career top researchers of any nationality, working - or moving to work - in host institutions in Europe. ... To date the ERC has funded over one thousand top researchers and their innovative, "blue-sky" research throughout Europe. ...

Еще в разделе: (Показать все результаты (>21) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/press_release_StG_2012.pdf

Date: 06/99 Title: Mean-field approximation for stochastic transportation network and stability of dynamical system Authors: D.V. Khmelev and V.I. Oseledets Abstract: A queuing system is considered, with a virtual node, $N$ nodes, and $rN$ servers. At each node (of these $N$ nodes) the arrivals of particles form a Poisson flow of rate $\lambda(t)$. For an empty node a particle leaves the system. A server at the node takes the particle and moves to a random node. ...

Еще в разделе: (Показать все результаты (>21) - old.philol.msu.ru/ )

• http://www.philol.msu.ru/~lex/khmelev/local/ijnabs2.ps

... Optical tweezers is the most convenient and widespread technique for spatial localization and manipulation of particles with dimensions of a few microns or less. ... The mapping technique based on this principle is known as photonic force microscopy. ... Magnetic microbeads interaction studied in optical tweezers . ... Optical tweezers technique is a unique approach to study these magnetic forces. ... Photonic force microscopy of surface electromagnetic waves in a one-dimensional photonic crystal" ....

Еще в разделе: (Показать все результаты (>30) - nanolab.phys.msu.ru/ )

NGS Data Analysis with Unipro UGENE Olga Golosova, Yuriy Vaskin, German Grekhov, Yuliya Algaer UNIPRO, Lavrentieva ave. ... That is where Unipro UGENE NGS framework comes in play. ... Moreover, the UGENE toolkit allows one to automate common tasks by creating workflows with the integrated tools using the UGENE Workflow Designer. Analysis of NGS data with UGENE may start, for example, from quality control of raw NGS data, received from a sequencing facility, with the integrated FastQC [3] tool. ...

Еще в разделе: (Показать все результаты (>87) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/2.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/243.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/237.pdf