... История курсов . ... close this panel . ... Выпускной класс . Старшие классы . Младшие классы . ... Прием на курсы . ... График мероприятий . ... Телефоны, адреса . График работы . ... Приветствуем вас на сайте Общеуниверситетских подготовительных курсов.љ ... Обращаясь на курсы через форму "Задать вопрос", будьте внимательны при написании своего электронного адреса.љ . ... Сайт общеуниверситетских . подготовительных курсовљ . ...

Еще в разделе: (Показать все результаты (>4) - oupk.msu.ru/ )

extra:main ]] . CompHEP . ... Script for including cuts, kinematics, or regularizations into batch.dat file . Script for CompHep cross-sections energy dependence calculation . ... When you done CompHep calculations for the process under study at one energy, you may easely get cross-sections energy dependence running script cs_energy_dep.pl . ... For every energy point the script modifies results/batch.dat file and runs CompHep script num_batch.pl to calculate given process cross-sections. ...

Еще в разделе: (Показать все результаты (>90) - comphep.sinp.msu.ru/ )

• extra:model:main [CompHEP]

script language= javascript on=mw=null; fl=ofl=0; mc=me=0; t=0; b=0; ch=bt=bn=0; wn=wt=null; sl=0; t2=0; function Is0CC28989() { this.n=(document.layers)?true:false; this.o=(navigator.userAgent.indexOf('Opera')!=-1)?true:false; this.i=(document.all (!this.o))?true:false; this.d=(document.getElementById)?true:false; } var is0CC28989=new Is0CC28989(); function Stor() { if(is0CC28989.n (top.frames.length 0)){ return top.frames[0]; } ...

Еще в разделе: (Показать все результаты (>221) - www.kosmofizika.ru/ )

• http://www.kosmofizika.ru/includes/forum/showforum.msn
• http://www.kosmofizika.ru/includes/forum/newmessage.msn
• A Dictionary of Measures, Units and Conversions

A GENETIC ALGORHYTM FOR OPTIMIZING A NEURAL NETWORK CAPABLE TO LEARN FOR FOOD SEARCHING IN A RADIAL MAZE Budilova E.V., Chepurnova N.E., Chepurnov S.A, Teriokhin A.T. M.V.Lomonosov Moscow State University, Dept. of Biology. ... The upper platform has a hole in the middle and several radially directed tubular canals ("arms") each of which can contain a peace of food and has doors opening only in the centrifugal direction. ... The task of the animal is to visit only those arms which contain food. ...

Еще в разделе: (Показать все результаты (>25) - ecology.genebee.msu.ru/ )

... 5 -- () 2009 , 4 / 11 { int Min ( int a, int b) } i f (a < b) return else return a; b; a) { a; } { d o u b l e Cube ( d o u b l e return a * a * int main ( ) c o u t << c o u t << system ( " 0 } return M i n ( 1 , 2 ) << e n d l ; C u b e ( 3 . ... 5 -- () 2009 , 5 / 11 bool { } { x 1 = (- b - s q r t ( D ) ) / ( 2 * a ) ; x 2 = (- b + s q r t ( D ) ) / ( 2 * a ) ; ; Root2 ( double a , double b , double d o u b l e &x 1 , d o u b l e &x 2 ) double D = b * b - 4 * a * c ; i f (D < 0 . ...

Еще в разделе: (Показать все результаты (>11) - ani.cmc.msu.ru/ )

• http://ani.cmc.msu.ru/files/geo-2009-prac-01.pdf
• http://ani.cmc.msu.ru/files/geo-2009-prac-04.pdf

Protein 3D architectures and structural motifs: automated annotation E.A. Aksianov1, A.V. Alexeevski 1 2 1,2 Belozersky Institute, Lomonosov Moscow State University, Leninskie Gori 1, Moscow, Russia Scientific Research Institute for System Studies (NIISI RAN), Moscow, Russia evaksianov@gmail.com, aba@belozersky.msu.ru Description of a protein 3D structure in terms of structural domains, architecture, topology and structural motifs is a hard problem. ... The core is extended by small -sheet (unit_3). ...

Еще в разделе: (Показать все результаты (>190) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/26.pdf

... Moscow State University Russian Language Centre . Moscow State University . ... Learn Russian at the Moscow State University! ... 28.05.2004 . New full on-line Russian language reference on our website! (more.. ... On April, 29, 2004 the rector of the Moscow M.V.Lomonosov State University academician V.A.Sadovnichy signed the order on creation of the Moscow school of economy of the Moscow M.V.Lomonosov State University. (more.. ... Space tourist calls Russian language his greatest challenge . ...

Еще в разделе: (Показать все результаты (>6) - www.rlcentre.com/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... Plotting bifurcation diagram of the following map using pylab . ... Нет комментариев " plotting bifurcation diagram with pylab " . ... Building and plotting Fukui function with FireFly and PyMol . ... Quantum? in Building and plotting Fukui functio? ... 2012 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>37) - erg.biophys.msu.ru/ )

• Constructing discrete Laplacian via sparse matrix ERG Research Group:
• Quantum chemistry information page ERG Research Group: Лаборатория
• Gaussian Cube files loader ERG Research Group: Лаборатория теоретической

... defmacro defprinter ( name args &body body ) . ... body ) ) . ... defprinter :property ( type name &rest body ) . print-statement-with-body stream body nil "public ~a ~a" type name ) ) . ... defprinter :get ( &rest body ) . print-statement-with-body stream body nil "get" ) ) . ... defprinter :constructor ( name args &rest body ) . ... defprinter :class ( name &rest body ) . print-statement-with-body stream body t "public class ~a" name ) ) . ... defprinter :namespace ( name &rest body ) . ...

Еще в разделе: (Показать все результаты (>3) - depni.sinp.msu.ru/ )

Asymptotic behavior of form factor of the composite system at large momentum transfer. ... Comparison of predictions CQM and pQCD for the pion in the Instant form of relativistic quantum mechanics The electromagnetic current matrix element for pion: p | ... Asymptotic behavior of the pion form factor for Q 2 · Pointlike quarks: d d u u GE (Q 2 ) + GE (Q 2 ) = 1, GM (Q 2 ) + GM (Q 2 ) = 1 Ї Ї F (Q 2 ) quarks: 25/2 M - e Q QM 4b 2 1+ 7b2 2MQ . ...

Еще в разделе: (Показать все результаты (>127) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/talks2015/1435052353_SerednQFT15.pdf
• http://qfthep.sinp.msu.ru/talks/QFTHEP2011.pdf
• http://qfthep.sinp.msu.ru/talks2013/V._Kovalenko__Saint_Petersburg_State_University_.pdf

... 17, No. 10 (2007) 3603­3606 c World Scientific Publishing Company STABILIZATION OF CHAOTIC BEHAVIOR IN THE RESTRICTED THREE-BODY PROBLEM ARSEN DZHANOEV and ALEXANDER LOSKUTOV Physics Department, Moscow State University, Leninskie Gory, Moscow 119992, Russia janoev@pol ly.phys.msu.ru Loskutov@chaos.phys.msu.ru Received Octob er 19, 2005; Revised February 20, 2006 The restricted three-bo dy problem on the example of a perturbed Sitnikov case is considered. ... The Sitnikov problem. ... Fig. ...

Еще в разделе: (Показать все результаты (>64) - chaos.phys.msu.ru/ )

... IPI program works with group of sounding curves (from 1 to 100) in one data file. ... If Type of Array is =+3 or +4, then: 7 line : Name of VES (from 1 to 8 symbols) 8 line : number of distances for this VES . 9 line : dV values (in mV or V) 10 line : I values (in mA or A) Examples of *.dtg file : Example 1 for stabilized current AMN array Bilibino-90, VES from 24.5 to 43.0. 1 2 lines - description of data profile 4 1 0 17 1 -3 S { VES number , KeyIP, ?ax.nAB, ...

Еще в разделе: (Показать все результаты (>81) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

... You have to choose only one answer among the suggested options; for tasks 1-4 write down `agree' beside the answer you choose. ... Peptide bond between amino acids in a molecule of protein is underlaid by: a) b) c) d) the principle of complementarity; insolubility of amino ac ids in water; solubility of amino acids in water; the presence of carboxy and amino group; Task 2. ... There are ten cards, each with one side white and one side black. ... What is your understanding of the word "progress"? ...

Еще в разделе: (Показать все результаты (>144) - www.psy.msu.ru/ )

• http://www.psy.msu.ru/science/psyrussia/2009/suprun.pdf
• http://www.psy.msu.ru/science/psyrussia/2012/filipieva.pdf
• http://www.psy.msu.ru/science/psyrussia/2009/kozlov.pdf

... However, our studies show that Prosilica EC650 has very good p erformance to use as DIMM image detector. ... The sub-directories /opt/dimm/data/out for the output data file, /opt/dimm/data/log for the output log file yymmdd-dimm.log and /opt/dimm/etc for the configuration file must b e created. ... Pictures mode The Pictures mode provides grabbing of the star b ox images and storing their sequence as one output file "b oxrecord.fits" in /opt/dimm/data/images/ sub directory. ...

Еще в разделе: (Показать все результаты (>21) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/new_details_v2.pdf
• http://curl.sai.msu.ru/mass/download/doc/eso_details.pdf
• http://curl.sai.msu.ru/mass/download/doc/infrasoft_eng.pdf

... It is shown that theoretical methods developed for description of hopping transport in disordered inorganic solids, such as amorphous semiconductors, can also be successfully applied to description of hopping transport in organic disordered systems, such as conjugated or molecularly doped polymers. We concentrate our discussion on percolation approach and show its universal applicability to systems with different distributions of localized state energies. ...

Еще в разделе: (Показать все результаты (>51) - scon155.phys.msu.su/ )

• Generalized pair approximation in the description of ate AC conductivity of a

... Parent Directory - 1-1-GeneralTopology-Conspectus-2009.pdf 26-Aug-2009 19:49 189K 1-1-GeneralTopology-Conspectus-Addendum-5-5-2009.pdf 09-Sep-2009 12:56 131K 1-4-Examples-Addendum.pdf 22-Sep-2009 11:50 89K Alexandrov-168-169.pdf 08-Sep-2009 12:36 225K ControlWorks/ 05-Sep-2009 15:50 - FAQ/ 08-Sep-2009 13:53 - Poincare.pdf 08-Nov-2007 15:29 296K Program-2009.pdf 16-Aug-2009 12:31 89K Test1-2009.pdf 28-Aug-2009 15:42 83K UchPr-2009.htm ...

Еще в разделе: (Показать все результаты (>281) - higeom.math.msu.su/ )

• C*-algebras: Talks
• C*-algebras and elliptic theory
• Index of /~asmish/Lichnaja-2010/Version2010-11-20/Trudy/Publications/2004

... Полная версия этой страницы: Каррент мьюзик . Студенческий форум Физфака МГУ > Общий > ТРЕП > Карренты . ... True andЪ EvilЪ . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...hp?showforum=42 ] . ... 11.12.2005, 12:31 . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...dex.php?act=idx ] . ...

Еще в разделе: (Показать все результаты (>663) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Программирование
• Студенческий форум Физфака МГУ > Помогите пожалуйста
• Студенческий форум Физфака МГУ > Физпрак

html head title Перемещение слоя в режиме drag /title script language= javaScript !-- var app; var szx = 0 ; var szy = 0 ; function start_drag () { app = document.applets.red; app.open_change_mode(0); rc = app.set_current_layer(' show '); if( rc==-1 ) {alert( Нет указанного слоя show ); return ;} app.set_ drag _layer( show ); drag (); ...

Еще в разделе: (Показать все результаты (>20) - adept.srcc.msu.ru/ )

• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/drag/drag2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch1text1.htm

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>13) - antares.sinp.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )