... It is shown that theoretical methods developed for description of hopping transport in disordered inorganic solids, such as amorphous semiconductors, can also be successfully applied to description of hopping transport in organic disordered systems, such as conjugated or molecularly doped polymers. We concentrate our discussion on percolation approach and show its universal applicability to systems with different distributions of localized state energies. ...

Еще в разделе: (Показать все результаты (>58) - scon155.phys.msu.su/ )

• Generalized pair approximation in the description of ate AC conductivity of a
• First-principles calculations of physical properties of crystals
• Oleg G. Koshelev

... A Model for the Interaction of Plane Waves with Nonlinear Interfaces . ... Cracks generated by fatigue or stress corrosion processes tend to have faces which conform to each other at the scale defined by the grain size. Thus, even a small compressive stress suffices to bring the surfaces in close contact, and dramatically changes the linear response of the defect to an incident ultrasonic wave. ... Three mechanisms responsible for the nonlinear behaviour of the interface are discussed. ...

Еще в разделе: (Показать все результаты (>101) - acs366.phys.msu.su/ )

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>15) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/seminar/Kulikovskiy.pdf

... COLAMO [1] . Fire!Constructor [2], . ... Fire!Constructor ( Include COLAMO). ... 4 - Fire!Constructor COLAMO - ARGUS. ... ARGUS : Define N = 5; Define K = 6; Define M = 1; DMC[0.A] # Metka : Read A step M repeat K; Add A, K; Loop N Goto Metka; DMC[0.C] # Metka1 : Read C step M repeat K; Add C, K; Loop N Goto Metka1; DMC[0.D] # Metka2 : Read D step M repeat K; Add D, K; Loop N Goto Metka2; DMC[0.B] # Metka3 : Write B step M repeat K; Add B, K; Loop N Goto Metka3; Read ­ , (.. ...

Еще в разделе: (Показать все результаты (>8) - fpga.parallel.ru/ )

Calcareous paleosols are widely distributed throughout the arid and semi arid regions of the world. These paleosols have been described from virtually every continent of the world, yet there is no internationally agreed upon nomenclature for the description of the horizons present within them. ... This abstract proposes the adoption of a universally agreed-upon system of horizon designation and gross morphological description of calcareous paleosols. ... Soil Science, 101, 347-360. ...

Еще в разделе: (Показать все результаты (>285) - www.fadr.msu.ru/ )

• NEW FARM RESOLUTION (From RUSAG conference)
• Foundation for Agrarian Development Research - Services - Portfolio
• The Period 1995 - 1999 of the Paleopedology Commission

Application of the Quickhull algorithm's principles to the double description method" . Bastrakov S.I., Zolotykh N.Yu. The double description method known also as the Motzkin-Burger algorithm is a method for computing the general solution of a system of linear inequalities. ... The numerical results demonstrate a number of advantages of the proposed modification over the original double description method and (in many cases) over the Quickhull algorithm. ... PostScript (in Russian) (1.51MB) . ...

Еще в разделе: (Показать все результаты (>204) - num-meth.srcc.msu.ru/ )

• "TreeDL: a language for description of graph structures and operations on them"
• "Automatic detection and description of supercomputer network infrastructure"
• "General description of subroutines for solving ordinary differential equations

... The name IE2DP1 means: Integral Equation (method of decision), 2D (dimension), P (point current electrodes), 1 - across inhomogeneities. IE2DP1 program fulfills two dimensional (2D) electric field modeling for different modifications of resistivity and induced polarization (IP) field techniques. ... Apparent chargeability is saved always in the file "IE2DP1.RES" and reference point is in current electrode location. ... Number of angular points for one body more than 40 5. ... Run file "start.bat". ...

Еще в разделе: (Показать все результаты (>64) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

Your Marketing Strategy Canada Business Service Centres - CBSCs 1. ... List your service(s) or product(s) . ... Personal Selling o Evaluate Media, Vehicles (Strengths/Weaknesses) o Target Market Analysis o Cost Advertising o Which media best reaches your customers? o When should you advertise? o How much should you spend? o How often should you advertise? o What should you advertise? o Cost/Benefit analysis Sales Promotion o What type of sales promotion should you do? o What form should it take? ...

Еще в разделе: (Показать все результаты (>34) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/english/settingupapaysystem.doc
• http://www.innovation.msu.ru/english/reportofinvention.doc
• http://www.innovation.msu.ru/english/marketingplanoutline.doc

... Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr. ... Lorem ipsum dolor sit amet. Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. <div class="myclass">...</div> . ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna. ...

Еще в разделе: (Показать все результаты (>4) - physcontrol.phys.msu.ru/ )

... Abstract A Uniform Resource Identifier (URI) is a compact string of characters for identifying an abstract or physical resource. ... This document defines a grammar that is a superset of all valid URI, such that an implementation can parse the common components of a URI reference without knowing the scheme-specific requirements of every possible identifier type. ... URI-reference = [ absoluteURI | ... Otherwise, the reference URI's scheme is inherited from the base URI's scheme component. ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1808.txt

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>55) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should
• Dolgov S., Khoromskij B.N., Oseledets I., Tyrtyshnikov E. A reciprocal

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

PHYSICAL REVIEW A 68, 022309 2003 Entangling quantum measurements and their properties B. A. Grishanin* and V. N. Zadkov International Laser Center and Department of Physics, M. V. Lomonosov Moscow State University, 119899 Moscow, Russia Received 20 December 2002; published 20 August 2003 We study the mathematical structure of superoperators describing quantum measurements, including the entangling measurement --the generalization of the standard quantum ...

Еще в разделе: (Показать все результаты (>81) - qilab.phys.msu.ru/ )

• http://qilab.phys.msu.ru/papers/LasPhys-2001-11(12)-en.pdf
• Quantum Information Lab, Int'l Laser Ctr. and Faculty of Physics, M.V.Lomonosov

... In our group one of the investigation lines is analysis of nonlinear oscillative systems, including chaotic phenomena. ... The most known oscillating chemical reaction which can exhibit various dynamical regimes (periodic, quasiperiodic, diffusive-induced chaotic, and chaotic) is the Belousov reaction. ... Chaotic dynamics in oscillating chemical reactions can appear as a result of nonlinearity of the mass-action law (for the spatially homogeneous media) and due to the diffusion processes. ...

Еще в разделе: (Показать все результаты (>114) - polly.phys.msu.ru/ )

Download FDSL 7.5 flyer ! home . ... The 7.5th European Conference on Formal Description of Slavic Languages, Moscow, December 6 8, 2008 . The European Conference on Formal Description of Slavic Languages was first held in 1995 at the University of Leipzig. Up till 2006, the biannual FDSL was hosted in turn by the University of Leipzig and Potsdam University. ... December 6 8, 2008 . ... FDSL 7.5 (halftime) will be held on December 6 8, 2008 at the Independent University of Moscow. ...

Еще в разделе: (Показать все результаты (>302) - www.philol.msu.ru/ )

• FDSL-7.5 | Call for Papers

Psychology in Russia: State of the Art · 2009 Relativist Psychology: a New Concept of Psychological Measurement 263 Relativist Psychology: a New coNcePt of Psychologic al MeasuReMeNt Anatoly P. Suprun Institute of systems analysis, Russian Academy of Sciences Moscow The article demonstrates the inadequacy in the traditional approach of psychology to the description of products of mental representation of perception. ... Here each vector coordinate corresponds to the intensity of a specific property. ...

Еще в разделе: (Показать все результаты (>127) - www.psy.msu.ru/ )

• http://www.psy.msu.ru/science/psyrussia/2009/shmeleva.pdf
• http://www.psy.msu.ru/people/izmailov/2006-bimler_paramei_izmailov.pdf
• http://www.psy.msu.ru/science/psyrussia/2009/nikolaeva.pdf

setup-gsi: Configuring GSI security Installing /etc/grid-security/certificates//grid-security.conf.42864e48.. Running grid-security-config.. G S I : C O N F I G U R A T I O N P R O C E D U R E Before you use the Grid Security Infrastructure, you should first define the DN (distinguished name) that should be used for your organization's X509 certificates. ... Installing Globus CA signing policy into trusted CA certificate directory... setup-gsi: Complete ...

Еще в разделе: (Показать все результаты (>9) - lhe.sinp.msu.ru/ )

• http://lve.sinp.msu.ru/~rud/Atlas/soft/site-info.def

Notice : Undefined index: idf in W:\Apache\wwwEnzyme\efremenko\ref.php on line 19 . Notice : Undefined variable: File in W:\Apache\wwwEnzyme\efremenko\ref.php on line 70 . ... Warning : fclose(): supplied argument is not a valid stream resource in W:\Apache\wwwEnzyme\efremenko\ref.php on line 72 . Laboratory of Ecobiocatalysis . ... Head of the laboratory: Ph.D., D.Sc., prof. Efremenko Elena N. Affiliation and official address: . ... E-mail: efremenko@enzyme.chem.msu.ru . ...

Еще в разделе: (Показать все результаты (>83) - www.enzyme.chem.msu.ru/ )

• PubMed medline query

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>18) - tukachev.flogiston.ru/ )

• Category: Новости

... Printed in the UK PII: S0305-4470(00)12866-5 Properties of some chaotic billiards with time-dependent boundaries A Loskutov, A B Ryabov and L G Akinshin Physics Faculty, Moscow State University, Moscow 119899, Russia Received 28 March 2000, in final form 25 July 2000 Abstract. ... It is shown that in all cases billiard particles can reach unbounded velocities. Average velocities of the particle ensemble as functions of time and the number of collisions are obtained. ...

Еще в разделе: (Показать все результаты (>65) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/loskutov/PDF/JPA_DLA_2007.pdf
• http://chaos.phys.msu.ru/loskutov/PDF/Reprint_JPA_2011_44_175102.pdf
• http://chaos.phys.msu.ru/loskutov/PDF/Letter_to_editor.pdf