... Stroboscopic Pulse Method of Nonlinear Parameters Measurements . ... The method is based on application of ultrasonic pulses and low frequency vibration to the sample. The high frequency ultrasonic pulse time of flight is measured in different phases of the low frequency vibration. ... The experiment was conducted in a sandstone bar with the ultrasonic pulse, frequency 6 MHz, propagating across the bar and the low-frequency vibration excited along the bar. ...

Еще в разделе: (Показать все результаты (>248) - acs366.phys.msu.su/ )

• Abstract (Invited)

... X-COM: Distributed Computing Software . ... The idea of distributed computing, or metacomputing, is to combine available computational resources for different applications processing. ... For these applications we simultaneously used high-performance computational resources of Moscow State University and Russian Academy of Sciences, computing centers of Saint Petersburg, Novosibirsk, Chelyabinsk, Ufa, Tomsk, etc. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>43) - hpc.msu.ru/ )

• APPLICATIONS: Theoretical Physics | Moscow University Supercomputing Center
• APPLICATIONS: Condensed Matter Physics | Moscow University Supercomputing...

. Please standby and you will be automatically connected to the new location of the unframed Supernova page. Or, click on the link above. If you have questions or problems, please email me at David Bishop dbishop@vhdl.org . Last modified: Mon Aug 27 12:40:15 EDT 2001

Еще в разделе: (Показать все результаты (>258) - www.rochesterastronomy.org/ )

• SN1989B in M66
• Supernova 1999gp in UGC 1993
• THE BRIGHT SUPERNOVA 1991T IN NGC 4527; AN AMATEURS PRESPECTIVE

... OPLS-AA topology generation is a very complex task because of huge amount of the atomtypes described this force field. ... TPPMKOP is an utility developed for the automatic topology generation working well with OPLS-AA force field. ... This database is continually upgrading by our research group. ... OPLS-AA patch for different types of molecules ERG Research Group: Лаборатория теоретической биофизики написал (Февраль 8th, 2016 4:27 дп) . ... All-atom automatic OPLS-AA topology generator . ...

Еще в разделе: (Показать все результаты (>58) - erg.biophys.msu.ru/ )

• Using spherical functions (from A.Granovsky manual) ERG Research Group:
• comcon1 ERG Research Group: Лаборатория теоретической биофизики
• OPLS-AA patch for different types of molecules ERG Research Group: Лаборатория

SAMSUNG Electronics Co., ... Peculiarities of Android OS , , / / , , , (Smart TV, Digital TV, IP TV, Embedded SW, System Programming, Android Platform , Messaging, SMART Phone, PCB Design , Noise Avoidance Design , Circuit Design , Multimedia Framework, Streaming (RTP / RTSP / HTTP), OpenMax / OMXIL(Codec / Muxer / Demuxer), Radio Interface Layer, GPS in Android Platform , C/C++, MFC, Linux , Java, Digital Signal · · Processing [DSP], Embedded Linux Core / File ...

Еще в разделе: (Показать все результаты (>92) - www.msu.ru/ )

• http://www.msu.ru/science/details/2010/101021-moscow-eu-ru-call.pdf

ARTICLE Alexander D. Ryabov 7 Vasily N. Goral Steady-state kinetics, micellar effects, and the mechanism of peroxidase-catalyzed oxidation of n -alkylferrocenes by hydrogen peroxide Received: 15 July 1996 / Accepted: 15 November 1996 Abstract Kinetics of the steady-state oxidation of n­alkylferrocenes (alkyl p H, Me, Et, Bu and C5H11) by H2O2 to form the corresponding ferricenium cations catalyzed by horseradish peroxidase has been studied in micellar systems of Triton ... Fig. ...

Еще в разделе: (Показать все результаты (>115) - www.enzyme.chem.msu.ru/ )

• http://www.enzyme.chem.msu.ru/ryabov/pdf/CEJ_98.pdf
• http://www.enzyme.chem.msu.ru/ekbio/article/Yemash_k_2006.pdf
• http://www.enzyme.chem.msu.ru/ryabov/pdf/ICA_00.pdf

... Erythrocyte and plasma protein modification in alcoholism: a possible role of acetaldehyde. ... Analysis of the oxidative modification of plasma and erythrocyte ghost proteins of chronic alcoholic subjects and healthy non-alcoholics has been performed. It was found that increased levels of protein carbonyls in both plasma and erythrocyte ghosts from alcoholic subjects occurred in comparison to the levels found in preparations from non-alcoholics. ...

Еще в разделе: (Показать все результаты (>88) - biochem.bio.msu.ru/ )

• Measurement of B-type natriuretic peptide by two assays utilizing antibodies
• Biochemistry Department of Moscow State University | Regulation of muscle
• The pivotal role of the beta 7 strand in the intersubunit contacts of different

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

... For SUSY this quantum numb er is R-parity, for IDM that is sp ecific D-parity 2 Most probable: Dark matter particle is neutral D0, Mass < 60 - 70 GeV,(to prevent annihilation D0D0 W +W - even slightly b elow threshold) The charged particles having the same quantum numb er DБ are heavier than 100 GeV (LEP), In the scalar case the counterpart with opp osite P-parity DA also exists, they are lighter than ab out 120 GeV(LEP). ... Their cross sections contains additional factor - two orders lower. ...

Еще в разделе: (Показать все результаты (>170) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/proceedings2015/Plenary_M.Dyndal.pdf
• http://qfthep.sinp.msu.ru/proceedings2015/Top_L.Massa.pdf
• http://qfthep.sinp.msu.ru/talks2011/Libanov_Neutrino.pdf

The Nine Planets is best viewed on-line via a graphical WWW browser which displays the pictures in color and supports hypertext link traversal. ... To view the movies and hear the sounds, you'll need additional helper programs. ... I recommend that you use Netscape as your browser. Netscape can display gif and jpeg images directly without need of any additional helper apps. You do need additional helper apps for movies and sounds, however. ... Yahoo's Helper Applications .. ... Tech Help .. ...

Еще в разделе: (Показать все результаты (>2) - www.iki.rssi.ru/ )

... Полная версия этой страницы: Работа в Samsung Electronics для математиков и программистов . Студенческий форум Физфака МГУ > Общий > Работа . Samsung_ . ... Работа в компании Samsung Electronics . Samsung Electronics объявляет набор технических специалистов (математиков, программистов, инженеров), заинтересованных в научно-исследовательской работе в исследовательских центрах компании, а также специалистов в области маркетинга и экономики. ... Математика, информатика, программирование . ...

Еще в разделе: (Показать все результаты (>834) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > НАУЧНО -ИССЛЕДОВАТЕЛЬСКАЯ РАБОТА В SAMSUNG
• Студенческий форум Физфака МГУ > Эластичные дисплеи уже скоро у вас дома!
• Студенческий форум Физфака МГУ > Каррент мьюзик

... In the domestic neuropsychological literature, these issues are need attention: standardized procedures for presenting stimuli are not, as a rule, described; basic psychometric assessment of the results of the tests is lacking; no investigation of their clinical and psychometric validity is carried out. ... First, it is necessary to develop adequate psychometric techniques that preserve the informative value of qualitative and quantitative diagnostic data, as well as their combinations. ...

Еще в разделе: (Показать все результаты (>158) - www.psy.msu.ru/ )

• http://www.psy.msu.ru/science/psyrussia/2013-2/podolskiy_2013.pdf
• http://www.psy.msu.ru/science/psyrussia/2013-3/2013_3_164-176.pdf
• http://www.psy.msu.ru/science/psyrussia/2012/isaychev.pdf

... 350, No. 7, 1996, pp. ... OCEANOLOGY Application of a Double-Flash, Impulse, Submersible Fluorimeter in the Determination of Photosynthetic Activity of Natural Phytoplankton D. N. Matorin, P. S. Venediktov, Yu. ... The intensity of fluorescence is used in oceanology as an indicator of chlorophyll concentration in reservoirs [8]. Photosynthetic activity may be evaluated by means of measuring the intensity of variable fluorescence dependent on PS2 [1, 4, 5, 7, 10]. ... Biofiz., 1990, vol. 40, pp. ...

Еще в разделе: (Показать все результаты (>36) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/matorin/3414.pdf
• http://mgumus.chem.msu.ru/publication/2001/perminova-quantification.pdf
• http://library.biophys.msu.ru/matorin/3379.pdf

... ICONO Invited Speakers . ... Gennadiy Kulipanov, Budker Inst. of Nuclear Physics, Russia . ... Marlan Scully, Texas A&M Univ., ... Andrey Goncharov, Inst. of Laser Physics, Russia . ... Vladimir Trunov, Inst. of Laser Physics, Russia . ... Since 1987, he has worked at the National Research Council of Canada (Ottawa) in the field of laser physics and trapped ion optical frequency standards. ... Alexey Taichenachev , Inst. of Laser Physics, Russia . ... S. Vatnik, Inst. of Laser Physics, Russia . ...

Еще в разделе: (Показать все результаты (>9) - iconolat13.phys.msu.ru/ )

• Guidelines

... K. Krylov . There was undertaken a research of lengthes of marinon - some integral units obtained by segmenting of comleted (whole) fiction prosaic texts (stories, small novels, novels). ... Overall corpus of considereded texts (Russian fiction prosaic) contain more than two million of graphic running words. Undertaken research has lead us to revealing of three main regularities. 1) to formulation of the law of optimum relation between number of elements within each submicroscopic level; . ...

Еще в разделе: (Показать все результаты (>54) - old.philol.msu.ru/ )

• MSU-LGCLL:: Papers submitted to QUALICO-94
• MSU-LGCLL:: O.V. Kukushkina, A.A. Polikarpov, D.V. Khmelev - Authorship
• Using Literal and Grammatical Statistics\\ for Authorship Attribution

Chemistry of Heterocyclic Compounds, Vol. ... 8, 1995 INSTRUCTIONAL TECHNIQUE IN HETEROCYCLIC CHEMISTRY COMPUTER ANIMATION: A NEW METHOD AND REPRESENTATION IN HETEROCYCLIC FOR TEACHING, OF KNOWLEDGE COMMUNICATION, ABOUT REACTIONS CHEMISTRY E. V. Babaev We propose the use of computer animation techniques .for representation of knowledge about organic reactions, in particular as applied to syntheses and transformations of heterocTcles. ... Let us briefly consider the capabilities of this program. ...

Еще в разделе: (Показать все результаты (>202) - www.chem.msu.ru/ )

• http://www.chem.msu.ru/eng/misc/babaev/papers/028e.pdf
• http://www.chem.msu.ru/eng/misc/babaev/papers/155e.pdf
• http://www.chem.msu.ru/eng/misc/babaev/papers/151e.pdf

About SPAW Editor . ... As of final version 1.0 of the control you'll need to rename the file spaw_control.default.config.php in config sub-directory to spaw_control.config.php when installing control for the first time. ... All of the SPAW Editor configuration options are located in the config/spaw_control.config.php file. ... This file will be included in img_library.php (Image library dialog script). $request_uri variable will be set to the URL of the page where SPAW Editor instance resides. ...

Еще в разделе: (Показать все результаты (>2) - textbook.sinp.msu.ru/ )

University Satellites and . Space Science Education . ... News . ... Internet seminars as the new way of Inter-University Aerospace Centre activity . ... In such a dynamic field as remote sensing, the Internet resources already beat traditional libraries and image depositories. ... In 2000-2005 seven Internet-based seminars were held: "Obtaining satellite images over Internet". ... Images of new types. ... Skobeltsyn Institute of Nuclear Physics, Moscow State University, 2005-2006 . ...

Еще в разделе: (Показать все результаты (>79) - cosmos.msu.ru/ )

ISTITUTO NAZIONALE DI FISICA NUCLEARE Sezione di Genova INFN/code-98/001 October 4, 2007 MEASUREMENT OF THE FREQUENCY RESPONSIVITY OF A FIBER OPTIC AIR BACKED MANDREL HYDROPHONE UP TO 10 KHZ IN AIR M.Anghinolfi1, A.Bersani1, A.Calvi3, A.Cotrufo3, M.Ivaldi1, O.Ershova2, F.Parodi1, D.Piombo1, A.Plotnikov2 and L.Repetto3 Hydrophone calibration was performed with the help of a microphone with a known frequency response characteristic. ... 3.2 F 1 F1 + F F = 23.9 kHz 380 ns ~130 ns 3200 ns FIG. ...

Еще в разделе: (Показать все результаты (>22) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/INFN%20-%20Paper%202.pdf
• http://antares.sinp.msu.ru/docs/Gracheva_Bamberg_22.09.11.pdf
• http://antares.sinp.msu.ru/seminar/Kulikovskiy.pdf

Выпускники 1968 . ... Список выпускников . Этот список мы не контролируем . ... список не полный . ... Список выпускников из зарубежья . ... Web - ...

Еще в разделе: (Показать все результаты (>74) - foroff.phys.msu.ru/ )

• Глубокоуважаемые коллеги