... D.V. Khmelev in [] has offered and tested statistically a technique giving correct predictions with quite a high probability. ... To the best of our knowledge, first attempts in the search of technique for author authorship attribution was given in []. ... The matrices of transition frequencies of element (letter, grammatical code, etc) pairs are calculated over all texts of each author. ... In Appendix written by D.V. Khmelev, another approach to authorship attribution is presented. ...

Еще в разделе: (Показать все результаты (>44) - old.philol.msu.ru/ )

• Using Literal and Grammatical Statistics\\ for Authorship Attribution
• Melnikov G.P.- Systemology and Linguistic Aspects of Cybernetics
• MSU-LGCLL:: DicTUM-1 - A System for Dictionary-Text Universal Manipulations and

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>139) - bioinf.fbb.msu.ru/ )

• SDPsite - Gallery of examples
• Alignment example

... Таня Трубичева, Коля Чеботарев, Сергей Меженный, Андрей Лебедев . ... Слева направо: Паша Зинюков, Булат Мавлюдов, Галя Ивутина (выше), Муся Григорян, Саша Игнатьев. ... Слева направо: 1)Аня Ноздрачева, 2)Дима Китаев, 3)Миша Ноздрачев, 4)Женя Цибиков, 5)Костя Фирсов, 6)Володя Трифонов, 7)Тамара Голубицкая, 8)Таня Михайлина, 9)Саша Игнатьев, 10)Валя Рябинкина, 11)Таня Чеботарева, 12)Оля Гусева, 13)Коля Чеботарев. ... Таня Гужва, Таня Немченко, Даниэль Усиков перед спуском в снежную . ...

Еще в разделе: (Показать все результаты (>17) - optics.sinp.msu.ru/ )

• Our publications
• polist99
• zagedan

Japan Student Services Organization (JASSO) Student Exchange Support Program Scholarship for Short-term Study in Japan [as of January 2016] This scholarship is available for qualified international students who are accepted by Japanese universities under student exchange agreements on a short-term basis. ... 7) Students who have a minimum GPA of 2.30 / 3.00 as calculated using JASSO's GPA calculation method shown below, based on a transcript from the previous academic year. ...

Еще в разделе: (Показать все результаты (>94) - phys.msu.ru/ )

• http://phys.msu.su/upload/iblock/ac4/firstcircular.pdf
• http://phys.msu.su/upload/iblock/941/gp2012appform.doc

University Satellites and . Space Science Education . ... Practical Training for Students in Simulated Satellite Navigation and Attitude Determination for Universitetskiy-Tatyana Satellite - an Overview . ... The practical training has been developed to provide a basic introduction for students into satellite navigation, satellite motion in space, Kepler orbits, and computational techniques involved in dealing with problems of navigation. ...

Еще в разделе: (Показать все результаты (>48) - cosmos.msu.ru/ )

• Space Scientific and Education project of Lomonosov Moscow State University

... We will dwell on linguistic aspects and Lexical Resources of POLITEXT branch having in mind some intermediate semantic representation of a whole text as the basis for differentiated Information Extraction. It is personal data (in the social sphere) recognition in texts that we focus on, see (Leontyeva et al. ... As the main instrument of semantic analysis of coherent texts this dictionary bears the important information on how to build BTF-units starting from lexemes of SemDict entries. ...

Еще в разделе: (Показать все результаты (>4) - leontyeva.srcc.msu.ru/ )

• Semantic Resources for Textual Content Compression

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom2_2013.pdf

... Randles impedance. Interfacial capacitance. ... Partial currents ik in the bulk solution are determined by transport numbers tk . ... dl Thermodynamics of interfaces ­ binary solution : 2 independent variables, e.g. = +/z+ - -/zsolution: dE+ = ( Cdl )-1 d - t -dl d(/F) d+ = - t+dl d - Cdl d(/F) EDL: + , d- = - t -dl d + Cdl d(/F) metal : THREE independent interfacial parameters: (1) Cdl , interfacial capacitance ( capacitance of the electrical double layer ), (2) t+dl et t-dl , ...

Еще в разделе: (Показать все результаты (>56) - electr003.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/rus/electrochemistry.pdf
• RADEN Data Bank

... Surface disturbance and deformat ion are shown in the same scale. Displac the free surface is much smoother as compared bottom deformations: init ial elevat ion has amplitude and spreads over a rather wide area. bottom theory, bottom ement of with the smaller F ­ velocity potential, H ­ depth, ­ vector of bottom deformation, 0 ­ initial elevation a . ... The init ial elevation assumed to be equal to the vertical bottom deformat ion (a); calculated with use of the Laplace smoothing algorithm (b). ...

Еще в разделе: (Показать все результаты (>54) - ocean.phys.msu.ru/ )

• Index of /courses/geo/lib/books/Brown x26; Mussett The Inaccessible Earth/
• Index of /courses/geo/lectures-addons/
• Index of /courses/geo/lectures-addons-11/

Lessons learned from the Thirty Meter Telescope site testing Tony Travouillon Sebastian Els, Angel Otarola, Reed Riddle, Matthias Schoeck, Warren Skidmore TMT.XXX.PRE.05.0XX.DRF01 1 Introduction TMT and its Site testing. Important choice before going on site. ... Considerations during analysis of the data. TMT.XXX.PRE.05.0XX.DRF01 2 Some Background about the TMT Site Testing TMT is a 30m, segmented, RitcheyChretien telescope design. ... ASCA Cloud Cover Analysis So how do we do it in practice? ...

Еще в разделе: (Показать все результаты (>25) - site2010.sai.msu.ru/ )

• http://site2010.sai.msu.ru/static/doc/Site2010-Summary.pdf
• http://site2010.sai.msu.ru/static/doc/ATokovinin_site2010.pdf
• Methods and instruments to measure/monitor major site properties

Doxyfile 1.4.6-NO # This file describes the settings to be used by the documentation system # doxygen (www.doxygen.org) for a project # # All text after a hash (#) is considered a comment and will be ignored # The format is: # TAG = value [value, .. ... USE_WINDOWS_ENCODING = YES # If the BRIEF_MEMBER_DESC tag is set to YES (the default) Doxygen will # include brief member descriptions after the members that are listed in # the file and class documentation (similar to JavaDoc). ... The default is NO. ...

Еще в разделе: (Показать все результаты (>11) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2013.PRIA.Levashov_Yurin.RidgeAndTree.en.pdf

NATO Publishing Unit P.O. Box 17 3300 AA Dordrecht A U T H O R 'S D A T A B A S E E N T R Y S H E E T (to be submitted together with the scientific paper ) REFERENCE: ARW978587 TITLE OF THE NATO MEETING/ NATO ASI SERIES VOLUME : Use of Humic Substances to Remediate Polluted Environments: from Theory to Practice NAME OF THE DIRECTOR: Dr. Norbert ... The total space available for keywords and abstract of your paper is 900 characters (approx. 100 words). ...

Еще в разделе: (Показать все результаты (>117) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/publication/2009/2009-kunenkov-total.pdf

European Research Council IDEAS Coordination and Support Action (CSA) Call identifier: ERC -2009-SUPPORT Guide for Applicants Version: 16 July 2008 The Guide is published by the ERC -DIS on http:// erc .europa.eu It can also be downloaded from the CORDIS page on http://cordis.europa.eu European Commission FP7 Specific Programme IDEAS ... Consequently, the ERC needs to be rigorous in evaluating the very best science and researchers and in selecting innovative and "high risk/high gain" projects. ...

Еще в разделе: (Показать все результаты (>34) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/guideline_third_country.pdf
• http://ideas.msu.ru/docs/Work_programme_2011.pdf
• http://ideas.msu.ru/docs/EPSS_guide.pdf

Laboratory of Liquid Crystals . ... LCOptimizer is a realization of algorithm for calculation of nematic and cholesteric LC structure in PDLC droplets. ... Current version of LCOptimizer software consists of the following units: . ... lcdis3 -- quick change of external field, surface tension or director field distribution in already prepared input file . ... User Manual . User Manual contains general information about the program, input and output description, and some additional tips. ...

Еще в разделе: (Показать все результаты (>299) - polly.phys.msu.ru/ )

• Science
• Main - Chair of Polymer and Crystal Physics
• Practicums - Chair of Polymer and Crystal Physics

... Scientific goals . ... Magnetospheric particles and radiation conditions . Automatic gaze stabilization corrector . Scientific equipment . ... An automatic gaze stabilization corrector can give an example. This device allows to improve the quality of the cosmonaut?s visual control of the moving objectsљ under the conditions of microgravity. This device must compensate the signal developed by the vestibular system of the cosmonaut. ... an automatic gaze stabilization corrector. ...

Еще в разделе: (Показать все результаты (>59) - lomonosov.sinp.msu.ru/ )

• IMISS-1 | Университетский спутник "Ломоносов"
• News | Университетский спутник "Ломоносов"
• DEPRON | Университетский спутник "Ломоносов"

... Contact information . ... The Computer Systems Laboratory (CSL) is an academic department within the Faculty of Computational Mathematics and Cybernetics of the Moscow State University. ... Research performed in CSL encompasses the performance analysis and simulation of distributed computer systems, software verification, development of scheduling and optimization algorithms, IT security for embedded systems and computer networks. ... Finding software vulnerabilities in information systems. ...

Еще в разделе: (Показать все результаты (>111) - en.cs.msu.ru/ )

• Laboratory of Industrial Mathematics | CMC MSU
• Laboratory of Industrial Mathematics
• The Computer Systems Laboratory

... Наука и учеба . ... Публикации . ... Наука . ... 18.03.2016 . ... Главная Наука и учеба Публикации . ... Абстракт: The Shannon information amount corresponding to two independent generalized measurements of all possible quantum states at the input and output is proposed as a natural quantitative characteristic of mutual information stored in two compatible sets of quantum states considered as an input and an output. ...

Еще в разделе: (Показать все результаты (>97) - ofvp.phys.msu.ru/ )

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>18) - observ.pereplet.ru/ )

• Обсерватория

Lomonosov Moscow State University . ... Academic Programs . Academic Board . International Cooperation . ... Academic Departments Programs . ... Bulletin of Moscow University . ... Contact Us . Phone Email Directory . ... Phone: (495) 734 03 22 . Fax: (495) 932 88 67 . ... Phone: (495) 932 99 15 . ... Faculty of Foreign Languages and Area Studies Lomonosov Moscow State University: . ... 2000 - 2016 Faculty of Foreign Languages and Area Studies Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>103) - ffl.msu.ru/ )

• About Us

... Войти в систему . ... Другие названия журнала: J.Bioactive Compatible Polym . ... Gebhart C.L. , Kabanov A.V. в журнале Journal of Bioactive and Compatible Polymers , издательство SAGE Publications (United States) , том 18, ? ... Kabanov V. , Yaroslavov A. , Boronina O. , Sukhishvili S. в журнале Journal of Bioactive and Compatible Polymers , издательство SAGE Publications (United States) , том 10, с. 41-50 . ...

Еще в разделе: (Показать все результаты (>1084) - istina.msu.ru/ )

• Sofiev M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Kukkonen J. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Mazur I.A. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического