... Главная -> Фильмы -> When Strangers Appear . ... Фильмы . ... When Strangers Appear . ... Австралия - США - Новая Зеландия 2001 . ... Когда перепуганный, истекающий кровью Мэтт входит в затерянное кафе, которым владеет Бет, там закручивается серия загадочных событий. ... Бет решает спасти Мэтта, но его последующее исчезновение и дальнейшее общение с гостями только еще больше запутывают ситуацию, и Бет все глубже и глубже погружается в пучину их опасных игр. ...

Еще в разделе: (Показать все результаты (>485) - kinfo.ru/ )

• Half Light - Фильмы - Kinfo.ru
• Friday Night Lights - Фильмы - Kinfo.ru
• In the Light of the Moon - Фильмы - Kinfo.ru

. Olga Leonidovna Kodolova . Resume . Main publications (ps-file) . Some publications from SLAC HEP database . Activity . Experiment . Some photos . To Hadronic Interactions Laboratory Home Page . Last update: February 15, 1999, ok@alex.npi.msu.su . ALEXEI

Еще в разделе: (Показать все результаты (>58) - lav01.sinp.msu.ru/ )

... Home News Colloquium on 24.02.11 . ... Prof. Gennady F. Voronin "New scientific programs of the laboratory for  2010" . ... New publications of the laboratory employees: . ... Colloquium on 23.12.10 . ... Colloquium on 24.12.12 20 Dec 2012 . ... Colloquium on 23.11.12 22 Nov 2012 . ... Colloquium on 19.10.12 15 Oct 2012 . Lomonosov Moscow State University . Department of Chemistry . ... Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>92) - td.chem.msu.ru/ )

• Colloquium on 21.02.08 Laboratory of Chemical Thermodynamics
• Colloquium on 26.02.09 Laboratory of Chemical Thermodynamics

... All rights reserved 0006-3509/96 $24.00+ .00 PH: 80006-3509(96)00171-8 TYPES OF NON-LINEAR BEHAVIOUR OF THE SYSTEM OF ION TRANSFER ACROSS THE MEMBRANE ON EXPOSURE TO A WEAK ELECTRIC FIELD* Ї 1 Ї T. Yu. ... L.- x Fig. ... Changes in the concentration of protons in response to external periodic perturbation external action A = 0.003 and critical frequency frequencies, periodic oscillations take place, x and potassium ions y in the near-membrane layer by a weak electric field. ...

Еще в разделе: (Показать все результаты (>37) - library.biophys.msu.ru/ )

... ДИМО' > Программные средства > Программа ДИМО Lights . ... Алгоритмы схемы ДИМО частично реализованы в программе ДИМО Lights . ... Для обеспечения максимальной гибкости настроек и облегчения анализа результатов, программа работает в непрерывном контакте с пакетом Microsoft Office Excel, который играет роль источника входных данных, хранилища промежуточных результатов и результатов моделирования. ... Входные данные алгоритмов берутся из текущей открытой книги Excel, согласно листу настроек. ...

Еще в разделе: (Показать все результаты (>9) - oc.cs.msu.su/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>152) - www.genebee.msu.ru/ )

• razjivin_dept
• AliGraf - GeneBee Graphical Alignment Help

... Институт . ... Студентам . Приветствуем вас на Официальном сайте Русско-германского института науки и культуры. Published by admin on April 6, 2016 under Новости . ... No Comments ? ... 09.00 - 15.30      736 - 1.ГУМ . ... Морозова Е.Б. пн.  17-00? 18-30, 18-45?20-15, 20-30?21-15  1 к., ауд.736 1 ГУМ . ... Башкиров В. М. вторник 15.00-17.00, четверг  15.00-17.00, 1 ГУМ ауд.736 . вторник 17.00-19.00, пятница 17.00-19.00 1 ГУМ ауд.736 . ... 736 1 Гум) . ... 7361 Гум) . ... December 2011 . ...

Еще в разделе: (Показать все результаты (>2) - rgi.msu.ru/ )

... Acousto-Optic Cells with Non-Uniform Length of Light and Sound Interaction . ... The paper examines operation of acousto-optic cells designed with cross section of acoustic columns different from the traditional rectangular form. ... It is evident that application of the ? transducers possessing the complicated shape of the electrodes results in unequal lengths of light and sound interaction over cross section of an incident optical beam. ... Section : 9 ...

Еще в разделе: (Показать все результаты (>199) - acs366.phys.msu.su/ )

• Abstract (Invited)

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Light Allow : не работает регулятор яркости . ... Re: Light Allow : не работает регулятор яркости [ re: Sash ] . ... Re: Light Allow : не работает регулятор яркости [ re: iDvs ] ...

Еще в разделе: (Показать все результаты (>6760) - www.snto-msu.net/ )

• Детализация рейтинга: light - Public forum of MSU united student networks
• Lights Out - Public forum of MSU united student networks

... help . find changesets by author, revision, files, or words in the commit message hg grep [OPTION].. ... Returns 0 if a match is found, 1 otherwise. options: -0 --print0 end fields with NUL --all print all revisions that match -a --text treat all files as text -f --follow follow changeset history, or file history across copies and renames -i --ignore-case ignore case when matching -l -- files -with-matches print only filenames and revisions that match -n --line-number print ...

Еще в разделе: (Показать все результаты (>1448) - kodomo.cmm.msu.ru/ )

• TracChangeset тАУ Tanchiki
• Script
• TracSyntaxColoring тАУ Tanchiki

Chlorophyll Fluorescence in vivo : A Theory (Part I) . Most part of the photosynthetic pigments in phytoplankton cell reside in peripheral pigment-protein complexes of the light-harvesting antenna (I, see Fig. ... From peripheral antenna complexes, excitation is efficiently transferred to core antenna complexes near photosynthetic reaction centers (II, Fig. 1), where it can be used in the primary photochemical reaction of photosynthesis. ... and phytoplankton concentration . ...

Еще в разделе: (Показать все результаты (>12) - www.biophys.msu.ru/ )

... Issues of the year 2010 . ... Instructions for Authors . ... The scientific English language journal ?GEOGRAPHY, ENVIRONMENT, SUSTAINABILITY? aims at informing and covering the results of research and global achievements in the sphere of geography, environmental conservation and sustainable development in the changing world. ... In the text the surname of the author and the year of publication of the reference should be given in square brackets, i.e. [Author1, Author2, 2008]. ...

Еще в разделе: (Показать все результаты (>228) - www.geogr.msu.ru/ )

• bbpgp
• gucci bags quote of art bag advance 24

Visualization of diffraction effects in the design of computer-generated holograms" . ... We consider a method for visualization of diffraction patterns arising in the cases when compound computer-generated holograms with diffraction gratings of various parameters are illuminated by white light. The method allows us to obtain real-time colored pictures of holograms when the light source and an observer move relative to each other. ... PostScript (in Russian) (378KB) . ...

Еще в разделе: (Показать все результаты (>132) - num-meth.srcc.msu.ru/ )

• Publication Ethics and Publication Malpractice Statement
• Publication Alerts

... Electromagnetic nature of light precursors of earthquakes / Natyaganov V.L. // Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>41) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Правила

... The sixth book "The Poetry of Moscow University: from Lomonosov and up to?" . has been published. The Poetry of Moscow University: from Lomonosov and up to? " . ... The idea of the project is to collect verses of all the poets who studied or worked in Moscow University. ... The greatest part of the works hasn?t been republished since they first appeared at the end of the 18 th , 19 th or the beginning of the 20 th century. ... In November 2005 the first printed book of poetry was published. ...

Еще в разделе: (Показать все результаты (>64) - lcl.srcc.msu.ru/ )

news ]] . ... Highlight news: CompHEP is in the top rating list on The OpenScience Project . ... 16/03/2009 New official version of CompHEP (4.5.1) is available. ... 14/11/2006 Two new versions of CompHEP-PYTHIA interface (cpyth-1.2.7 and cpyth-2.0.4) are available. ... 13/09/2006 A new version of CompHEP-PYTHIA interface and a new interface CompHEP-HERWIG has been released. ... 01/07/2006 Talk on new physics with CompHEP by M.Dubinin at Tools for SUSY and the New Physics (LAPP, 26-28 June 2006). ...

Еще в разделе: (Показать все результаты (>19) - comphep.sinp.msu.ru/ )

... Russian: ps 2 pages . Published in: Russian Math. Surveys 57 (2002), no.3. ... English: ps (gzipped) 41 pages . ... Finitely presented groups and semigroups in knot theory. Russian: ps (gzipped) tex . English: ps (gzipped) tex . ... Russian: ps (gzipped) English: ps 20 pages . arXiv.org e-Print archive: http://arXiv.org/abs/math.RA/0205042 . ... Russian: ps English: ps 11 pages . ... In this paper we introduce and study gauge-equivariant $K$-theory groups $K_\GR^i(Y)$. ...

Еще в разделе: (Показать все результаты (>151) - higeom.math.msu.su/ )

• Alexey Garber
• Publications (Russian)
• Index of /~asmish/Lichnaja-2010/Version2010-11-20/Trudy/Publications/1970

... Summury: Usually a water column consists of two big layers. The upper layer (10-50 m deep) is characterized by strong mixing, as a result, both the biomass and nutrients are nearly uniformly distributed there. ... In this article we show that in the presence of an upper mixed layer (UML) there can be two stable vertical distributions of phytoplankton biomass: either the bulk of the biomass is located within the upper layer or below it. ...

Еще в разделе: (Показать все результаты (>70) - chaos.phys.msu.ru/ )

• Evolutionary motion

... Scientific laboratories . ... lve@cs.msu.su . ... The Laboratory of Computational Electrodynamics was organized in 1969 as a department of the Computing Center at the Faculty of Mechanics and Mathematics of the Moscow State University. ... Numerical methods are based on the method of discrete sources and the integral equation method. ... Yu.Eremin, E.Eremina, and Th.Wriedt, Computational nano-optic technology based on discrete sources method (review) // J. Modern Opt., vol. 58, no. 5-6, pp. ...

Еще в разделе: (Показать все результаты (>243) - en.cs.msu.ru/ )

• Department of Algorithmic Languages
• International Scientific Conference "Probability Theory and its Applications"
• Laboratory of Computational Electrodynamics

... (experiment) Optical: 2 3 *) CBP Conclusion: the ET in OLED active centers is mainly associated with local molecular modes , rather than with medium polarization modes , as in usual ET theories 2 *) V. Ruhle et al, JCTC 7 (2011) 3335-3345 2 ... Active ET local motions: Reorganization mode X (intramolecular) Transfer integral: n J nn ^ = J 0 n ( X ) J X n ( X ) d ^ J X = exp - (shift operator ) dX (X) are oscillator functions: J nn = J 0 n ( X ) | ... Includes the Kubo function f(z). ...

Еще в разделе: (Показать все результаты (>20) - www.elch.chem.msu.ru/ )