... Version history . ... Fortran-DVM and C-DVM languages supported data distribution by equal blocks and corresponding distribution of parallel loop iterations (data parallelism). ... A new toolkit - DVM-program performance analyzer was included in the version. ... Fortran-DVM and C-DVM languages support now data distribution by non-equal blocks and parallel executed program section specification (task parallelism). ... The version 3.30 (27.12.2000) is differ from version 3.15 in the following: . ...

Еще в разделе: (Показать все результаты (>80) - sp.cs.msu.ru/ )

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>10) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search

... Hittite-Luvian Bilingualism and the Origin of Anatolian Hieroglyphs' . ... Journal of Ancient Near Eastern Religions 5 (2005): 107-37. ... Wiesbaden: Harassowitz, 2005, pp. ... Moscow: Languages of Slavonic Culture, 2002, pp 93-116. ... Proceedings of the Nineteenth Annual UCLA IE conference (ed. K. Jones-Bley et al.) Washington, DC: Institute for the Study of Man, 2008, pp. ... Proceedings of the Seventeenth Annual UCLA IE conference , Los-Angeles, October 27-28, 2005 (ed. K. Jones-Bley et al.) ...

Еще в разделе: (Показать все результаты (>20) - imk.msu.ru/ )

news ]] . ... Highlight news: CompHEP is in the top rating list on The OpenScience Project . ... 16/03/2009 New official version of CompHEP (4.5.1) is available. ... 14/11/2006 Two new versions of CompHEP-PYTHIA interface (cpyth-1.2.7 and cpyth-2.0.4) are available. ... 13/09/2006 A new version of CompHEP-PYTHIA interface and a new interface CompHEP-HERWIG has been released. ... 01/07/2006 Talk on new physics with CompHEP by M.Dubinin at Tools for SUSY and the New Physics (LAPP, 26-28 June 2006). ...

Еще в разделе: (Показать все результаты (>15) - comphep.sinp.msu.ru/ )

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Ищу картинки. Massive Attack . ... Заберу все картинки которые имеют отношение к Massive Attack. ...

Еще в разделе: (Показать все результаты (>2901) - www.snto-msu.net/ )

• Пятый чемпионат ГЗ по Pro Evolution Soccer - Public forum of MSU united student
• Evolution de l'Europe de l'an 1000 à 2005 - Public forum of MSU united
• Pro Evolution Soccer 2008 - Public forum of MSU united student networks

Publications . General Information . ... For physics faculty . ... For natural faculties . ... At this page the list of all publications of members of the department is represented. ... List of publications for 1998 . List of publications for 1999 . List of publications for 2000 . List of publications for 2001 . Note: The publications is given in English only that publicated in anglo-language journals. ... Amount of publications in recent years: . ...

Еще в разделе: (Показать все результаты (>37) - ferro.phys.msu.ru/ )

• Department of General Physics and magneto-ordered matter. Physics Department of
• Кафедра общей физики и физики конденсированного состояния

Theoretical problems of electrical double layer structure on ideally polarizable electrodes and reversible adsorption of ions and neutral organic molecules on electrodes are considered, and also the specific features of kinetics of multistep electrochemical processes limited by mass transfer, electron transfer and chemical reaction. Special attention is paid to computer simulation of specific adsorption and coadsorption of ions and neutral organic molecules on the electrode surfaces. ...

Еще в разделе: (Показать все результаты (>114) - electr003.chem.msu.ru/ )

• Boris I. Podlovchenko: Selected Publications
• Laboratory of Electrochemical energetics
• Veronika K. Laurinavichute: Selected Publications

05 Nov 2003 The Sun has continued its recent high levels of activity. At 1950 UT, 4 November 2003, a class X28 solar flare was released by the Sun. ... LASCO C2 Images of X28 Flare at 1950UT 04/11/2003 . ... SOHO (Solar and Heliospheric Observatory) is located between the Sun and the Earth and will, therefore, detect activity before it reaches the Earth. ... All this ongoing solar activity means that the Earth is destined to be bathed in more radiation - generating further auroral displays. ...

Еще в разделе: (Показать все результаты (>181) - www.kosmofizika.ru/ )

• СПУТНИКИ . Некоторые сведения .
• IMAGE-FUV, October 2003 Storm
• Константы

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>1081) - kodomo.cmm.msu.ru/ )

• Practice1(evolution)
• Evolution model
• Gene Evolution Reconstruction

... In: Earth Science Reviews, . ... The reason that this book-length (159 pp) discussion of climatic models for the geologic past is reviewed here is that about half of its content deals with chemical and microbiotic weathering processes and their effects in soils from ancient rock surfaces to current rhizosphere characteristics. ... Soils teem with life. ... For Earth scientists, ancient and buried soils are one of the better proxies for reconstructing past climate and the development of the landscape...

Еще в разделе: (Показать все результаты (>159) - www.fadr.msu.ru/ )

• PROTOCOL of Paleopedology Commission Business Meeting at V International
• Commission publications
• Klumpen?a Mesoscale Level of Classification for Soil Structure: Rationale

Twilight observations with MASS/DIMM B. Safonov Sternberg Astronomical Institute Moscow State University Comprehensive Characterization of Astronomical Sites, 2010 B. Safonov (Moscow State University) Twilight observations with MASS/DIMM SITE 2010 1 / 17 Why observe in twilight with MASS/DIMM? ... ASM includes 3 devices sensitive to background: guider, DIMM and MASS. B. Safonov (Moscow State University) Twilight observations with MASS/DIMM SITE 2010 2 / 17 Background in guider. ...

Еще в разделе: (Показать все результаты (>21) - site2010.sai.msu.ru/ )

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

93. Студенческий форум Физфака МГУ > черные дыры в новостях

94. silicon detector laboratory

95. Lesson 1: getting the most power of your multicore, SMP system or cluster with

96. http://geo.web.ru/~ariskin/docs/papers/a_2010_adelaide_ariskin.pdf

97. Лаборатория Физико-химической газодинамики

98. Publications

99. Scientific Literature

100. . The . MASS . Group .