AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>147) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help

... Geography of World Economy . ... Field stations . ... Type of field courses . ... Khibiny station . ... Arkhangelsk station . ... The Arkhangelsk (Ustiayansk) research and training field environmental station is located in Ustiayanskyi district of the Arkhangelsk Region in the interfluve area of Vaga and Northern Dvina rivers. ... Emelianova L.G., Goriayinova I.N., Miaylo E.G. The Life of Taiga (Ecological Excursions in Ustiayanskyi district of the Arkhangelsk Region) M., Arkhangelsk. 1999. 162 pp. ...

Еще в разделе: (Показать все результаты (>65) - eng.geogr.msu.ru/ )

• Department of Cryolithology and Glaciology
• Publications

... Dynamic Chaos and Fractals in Speech Rhythm . ... But it's yet rather surprisingly that this especially physical approach has appeared even more productive for explanation of many effects in such far from an engineering area as stuttering. In this paper we show the large-scale Voice/Unvoice temporal structure of normal and destroyed acoustic speech signal possesses the dynamical regimes set. ...

Еще в разделе: (Показать все результаты (>202) - acs366.phys.msu.su/ )

• Abstract (Invited)

... ACAT'2003 : IX INTERNATIONAL WORKSHOP ON ADVANCED COMPUTING AND ANALYSIS TECHNIQUES IN PHYSICS RESEARCH (ACAT03), 1-5 December, 2003, Tsukuba, Japan. ... Advanced Statistical Methods for Data Analysis Traditionally, researchers from high energy and nuclear physics together with experts in computer science take part in the ACAT series of workshops. ... Thus, researchers from these and other fields are welcome to join us in discussions on modern computing techniques and ways for new developments. ...

Еще в разделе: (Показать все результаты (>54) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/shawhan/shawhan_plenary.pdf
• http://acat02.sinp.msu.ru/news.html

... Identification and establishment of authenticity of medicines of group of neuroleptics of derivative benzamids when using color reactions . ... Key words: neuroleptics, amisulpride, tiapride, sulpiride, color reactions. Moscow University Chemistry Bulletin . 2012, Vol. ... 5, P. 350 . Copyright (C) Chemistry Dept., Moscow State University, 2002 . ... Copyright (C) Chemisty Department of Moscow State University . ... Web-design: Copyright (C) MIG and VVM . ...

Еще в разделе: (Показать все результаты (>729) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 48, No. 3, P. 147 (2007)
• Alexey V. Bogdanov
• Elena N. Golubeva

... All rights reserved 0006-3509/96 $24.00+ .00 PH: 80006-3509(96)00171-8 TYPES OF NON-LINEAR BEHAVIOUR OF THE SYSTEM OF ION TRANSFER ACROSS THE MEMBRANE ON EXPOSURE TO A WEAK ELECTRIC FIELD* · 1 · T. Yu. ... L.- x Fig. ... Changes in the concentration of protons in response to external periodic perturbation external action A = 0.003 and critical frequency frequencies, periodic oscillations take place, x and potassium ions y in the near-membrane layer by a weak electric field. ...

Еще в разделе: (Показать все результаты (>36) - library.biophys.msu.ru/ )

Электронная библиотека Попечительского совета . ... Ellis J.W. - The near infra-red absorption spectrum of calcite . ... Название: The near infra-red absorption spectrum of calcite . Автор: Ellis J.W. Язык: . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>10411) - lib.mexmat.ru/ )

• Shapley H. - Studies of the Magnitudes in Star Clusters IV. On the Color of
• Circuit Cellar (February 2007) :: Электронная библиотека попечительского совета
• Circuit Cellar (February 2000) :: Электронная библиотека попечительского совета

... Bashindzhagyan G . ... Panasyuk M . ... Proc.26th ICRC, Salt Lake City , 1999, v.5, p.132-135. Bashindzhagyan G.L., Samsonov G.A., Khein L.A., Panasyuk M.I., . Voronin A.G., Zatsepin V.I., ATIC Collab .. The Advanced Thin Ionization Calorimeter (ATIC) for Studies of High . ... Proc. 26th ICRC, Salt Lake City , 1999, v.5, p.9-12. ... Silicon Matrix Detector for ATIC . ... Proc. 26th ICRC, Salt Lake City , 1999, v.5, p.453-456. ... Advanced Thin Ionization Calorimeter (ATIC) .- ...

Еще в разделе: (Показать все результаты (>27) - silab.sinp.msu.ru/ )

Preliminary results of astroclimate parameters measurements at the Sternberg 2.5m telescope installation site V.Kornilov, N.Shatsky, S.Potanin, O.Voziakova, B.Safonov Moscow, 2008 Acknowledgements A.Belinskiy M.Kornilov A.Tokovinin M.Kuznetsov P.Kortunov E.Gorbovskoy SAI administration some SAI students Pulkovo solar station (KHSS) staff RFBR support MAVEG Gmbh Why to study optical turbulence and some other relevant ... Mean seeing by DIMM data for this night is 1''5. ...

Еще в разделе: (Показать все результаты (>22) - curl.sai.msu.ru/ )

... Trac has a built-in functionality for visualizing тАЬdiffsтАЭ - changes to files. ... Line numbers on the left side indicate the exact position of the change in both the old and the new version of the file. ... When viewing a repository check-in, such as when following a changeset link or a changeset event in the timeline , Trac will display the exact changes made by the check-in. ... The last possibility for examining changes is to use the Last Change link provided by the TracBrowser . ...

Еще в разделе: (Показать все результаты (>1564) - kodomo.cmm.msu.ru/ )

• Script
• TracSyntaxColoring тАУ Tanchiki
• Help: grep

... Criteria of branch quality . As it was repeatedly told , phylogenetic trees consist from branches. ... I. e., those positions, which can separate sequences of the branch from other sequences in the alignment. ... Measure of branch separation . ... Here and further: A - branch of the tree, i , j - sequences of alignment . ... That's why number of conserved positions in some branch should be considered in complex with the distribution of conserved positions in the whole alignment. ...

Еще в разделе: (Показать все результаты (>32) - monkey.belozersky.msu.ru/ )

• HTH3_HBonds
• S publications
• About this project

О лаборатории . ... Лаборатория теоретической биофизики . ... OPLS-AA topology generation is a very complex task because of huge amount of the atomtypes described this force field. ... We use OPLS-AA with some includings; ?includings? are overlays on the standart GROMACS forcefield files. ... All-atom automatic OPLS-AA topology generator . ... comcon1 in All-atom automatic OPLS-AA topology? . ... OPLS-AA? in All-atom automatic OPLS-AA topology? ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>58) - erg.biophys.msu.ru/ )

• topology ERG Research Group: Лаборатория теоретической биофизики
• OPLS ERG Research Group: Лаборатория теоретической биофизики
• OPLS-AA patch for different types of molecules ERG Research Group: Лаборатория

... Research objects and scientific purposes . Space scientific program includes development and launch of two supersmall spacecrafts "Universitetskiy" and "Kompas-2" intended for monitoring of radiation conditions near the Earth. ... All the studies conducted in the near-Earth space are characterised by strong radiation fields. ... The circular polar orbits, which cover all the near-Earth space, are the most favorable for comprehensive studies of the radiation conditions near the Earth. ...

Еще в разделе: (Показать все результаты (>6703) - cosmos.msu.ru/ )

• University Satellites and Space Science Education '2006

обзор! astro-ph/0207223 . ... Author: Sultana N. Nahar . Comments: 15 pgs., 5 color figs., ... Comments: 46 pages including 16 figures, uses eas.cls, to appear in the proceedings of the Aussois 2001 summer school "Stades Ultimes de l'Evolution Stellaire", EAS Pub. ... Comments: 26 pages, 5 figures, submitted to ApJ . ... Commets: 5 pages, 4 figures, to appear in: Pis'ma v Astronomicheskii Zhurnal, 2003, v.29, No.2, p111-115 and will be translated as: Astronomy Letters, v.29, No.2, p.91-95 . ...

Еще в разделе: (Показать все результаты (>432) - astro.uni-altai.ru/ )

• http://xray.sai.msu.ru/~polar/sci_rev/2002-07_2003_03/snr.html
• Обзоры препринтов astro-ph
• Новости науки

... General Information . ... For physics faculty . ... For natural faculties . ... Lomonosov Moscow State University is situated on the south-west of Moscow. The Department is placed at Physics Faculty, wich building is near the main building of MSU. ... Department of General Physics and magneto-ordered matter, . Faculty of Physics, . M.V.Lomonosov Moscow State University, . Leninskie gory, Moscow 119992, Russia . ... E-mail: . ...

Еще в разделе: (Показать все результаты (>35) - ferro.phys.msu.ru/ )

• Laboratory of Ferroelectricity
• Physics Department of Moscow State University

... 2, Moscow 123182, Russia Sergey V. Razin Institute of Gene Biology, RAS, Vavilova st. 34/5, Moscow 119334, Russia sergey.v.razin@usa.net In Drosophila, interphase chromosomes are organized in topologically associated domains (TADs) within which chromatin-chromatin interactions are frequent, while interactions across domain borders are rare [1]. ... Here we used Hi-C method [5] to map TADs in four drosophila cell lines of different origin. ... Cell 48:471­84. ...

Еще в разделе: (Показать все результаты (>237) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/115.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/141.pdf

... Search for Single Top Quark Production at DZero using Neural Networks" . ... Search for Single Top Quark Production at D0 Using Neural Networks" . ... Search for Electroweak Production of Single Top Quarks" . ... Use of Neural Networks in a Search for Single Top Quark Production at D0", . ... Search for Single Top Quark Production at the Tevatron" . ... Use of Neural Networks in a Search for Single Top Quark Production with the DZero Detector at the Fermilab Tevatron Collider", . ...

Еще в разделе: (Показать все результаты (>9) - top.sinp.msu.ru/ )

• Lev V. Dudko Home Page

... Submit your article . ... Public Administration publishes scholarly articles on theory, methodology and practice of management, results of applied research projects in administration, studies of Russian and foreign administration experience, bibliographical reviews and information on conferences, round tables and workshops. ... The journal accepts polemic articles. ... All articles submitted for publication are first reviewed for compliance with the guidelines for article formatting and content. ...

Еще в разделе: (Показать все результаты (>175) - ee-journal.spa.msu.ru/ )

Sign in Register . ... Resources . ... Blog . 495) 3334-65-56 . info@ecfs.msu.ru . All contacts . ... Home Kucheriavenko Ekaterina . Kucheriavenko . Ekaterina . ... Registered: 21 december 2015 in 23:28 . ... Contacts . The Department of land resources . ...

Еще в разделе: (Показать все результаты (>62) - ecfs.msu.ru/ )

• Brown Lynn | ECFS
• Events list | ECFS
• News | ECFS

... For students . ... 25 February 2016 We congratulate Plastinin Ivan and Vervald Alexey who have become PhD students! 25 January 2016 We congratulate Kirill Laprinskiy who won scholarship of M.V. Lomonosov for the young scientists! ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>43) - rswater.phys.msu.ru/ )