... On Applications of Group Analysis of Differential Equations in Analytical Dynamics. ... I.S.Yemelyanova (Nizhny Novgorod State University, Nizhny Novgorod, Russia) . ... A course "Group analysis of differential equations and its applications'' [1,2] for Nizhny Novgorod State University students and postgraduates contains group theoretical methods in analytical mechanics. ... Nizhny Novgorod: Univ. ... Yemelyanova I.S. Group analysis of differential equations. ...

Еще в разделе: (Показать все результаты (>133) - acs366.phys.msu.su/ )

Announcement On November 2-3, 2005 Lomonosov Moscow State University will conduct jointly with the Academy of Cryptography of the Russian Federation the Fourth All- Russian Conference Mathematics and Security of Information Technologies [Cybersecurity?] and jointly with the Center of International Studies, Cambridge University , United Kingdom, Advanced Research Workshop Unconventional ... Sherstyuk V.P. - Security Council of the Russian Federation; 3. ... Organization Committee 1. ...

Еще в разделе: (Показать все результаты (>16) - suny.msu.ru/ )

• http://suny.msu.ru/ru/ProgramMaBIT05En.doc

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>4) - npidb.belozersky.msu.ru/ )

... Structure of Data . ... Catalog . ... The SAI OCL Catalog site provides several VO-enabled modes of operation: . VO-enabled catalog data analysis from a browser . ... Endpoint URL is http://ocl.sai.msu.ru/catalog/conesearch/ . ... VO-enabled catalog analysis from a browser . Presently, this recipe works with Firefox (Windows, MacOS, Linux), Internet Explorer (Windows) and Opera (Windows) browsers with Java plugin 1.6 installed. ... Main TOPCAT window with SAI OCL catalog loaded will appear. ...

Еще в разделе: (Показать все результаты (>2) - ocl.sai.msu.ru/ )

... References . ... References to books should include the author's name; year of publication; title; page numbers where appropriate; publisher; place of publication, in the order given in the example below. ... Ramirez, F. J., Marquez, R. A. C., and Mondaca, G.: 1991, The 1877 great tsunami and the rapid local warning network in the coast of Northern Chile - South America, In: Proc. International Conference of Australian Earthquake Engineering Society , Brisbane, Australia, 25-1. ... Information . ...

Еще в разделе: (Показать все результаты (>17) - seac47-2.phys.msu.ru/ )

... Guidelines for Paper Submission . ... The program committee will schedule both oral and poster sessions. The abstract and summary of both oral and poster papers are published in the same manner in the Conference Program and the Technical Digest on CD-ROM. ... Oral Sessions . ... Poster Sessions . ... For poster sessions, authors are provided with bulletin boards on which to display their papers, along with a sign indicating their paper numbers, and pushтАУpins or adhesive tape. ... Program . ...

Еще в разделе: (Показать все результаты (>22) - iconolat13.phys.msu.ru/ )

Microsymposium 38, MS019, 2003 (letter format) ESA SMART-1 MISSION TO THE MOON B.H. Foing1, G. Michael1, G.R. Racca2, A. Marini2, M. Grande, J. Huovelin, J.-L. Josset, H.U. Keller, A. Nathues, D. Koschny, A. Malkki (SMART-1 Science and Technology Working Team) 1 ESA Research and Scientific Support Dept., ESTEC/SCI-S 2 ESA Science Projects Dept., ESTEC/SCI-PD Bernard.Foing@esa.int SMART-1 is the first in the programme of ESA's Small Missions for Advanced Research and Technology. ...

Еще в разделе: (Показать все результаты (>89) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Bus/Publications/ms40/15_Busarev_etal.pdf
• http://selena.sai.msu.ru/Ber/Publications/ms40/88_Yamashita%20et_al.pdf
• http://selena.sai.msu.ru/Rod/Publications/ms38/ms035.pdf

... Menzerath's Law for Morphemic Structures of Words: . A Hypothesis for the Evolutionary Mechanism of its Arising and its Testing . Anatoliy A. Polikarpov . ... Key words: Menzerath's Law, morphemic structures, language evolution . ... In this paper there is present (1) a hypothesis for understanding the evolutionary mechanism responsible for the Law arising and (2) some data for testing the hypothesis. ... A Hypothesis. ... Altmann, G. Prolegomena to Menzerath's Law//Glottmetrika 2. ...

Еще в разделе: (Показать все результаты (>37) - old.philol.msu.ru/ )

• MSU-LGCLL:: Polikarpov A.A.- Chronological Morphemic and Word-Formational
• HumLang - Polikarpov A.A.- Chronological Morphemic and Word-Formational
• MSU-LGCLL:: Anatoliy A.Polikarpov - Explaining Basic Menzerathian Regularity:

... CENTRE FOR PHOTONUCLEAR EXPERIMENTS DATA . Online Services | ... CDFE: Online Services . ... Coded (machine-retrievable) information . ... DATA . ... This appendix provides a listing of all information-identifier keywords, along with details about their use. ... The general format of the coding string consists of three major fields which may be preceded by a decay flag: ((decay flag)nuclide,half-life,radiation). ... Gives information on references that contain information about the data coded. ...

Еще в разделе: (Показать все результаты (>29) - cdfe.sinp.msu.ru/ )

• CDFE => Online Services => Nuclear Reaction Threshold and Energy Values

Unit I2 Mathematical language 4 Two identities After working through this section, you should be able to: (a) understand and use the Binomial Theorem; (b) understand and use the Geometric Series Identity; (c) understand and use the Polynomial Factorisation Theorem. ... The roots of a p olynomial are also known as its zeros. ... We obtain the first of these equations by comparing the coefficients of xn on the two sides of the equation xn + a n-1 xn -1 + ··· + a1 x + a0 = (x - 1 )(x - 2 ) ··· (x - n ). ...

Еще в разделе: (Показать все результаты (>21) - www.eng.math.msu.su/ )

БАКАЛАВРИАТ . ... MBA . EXECUTIVE MBA . ... Выставка 'Executive MBA и обучение для топ-менеджеров' . ... 3 марта 2008 года, 18.00 21.00 . Отель "Балчуг Кемпински", ул. Балчуг, 1 (м. Новокузнецкая, Китай-город) . http://www.begin.ru/db/b2/root_id/executive_exibition/doc.html . ... Executive MBA . ... Бакалавриат . ... Оплата обучения . ... Аккредитация программы Бакалавр . Аккредитация финансовых курсов программ Бакалавр и Магистр . ...

Еще в разделе: (Показать все результаты (>59) - www.mgubs.ru/ )

• Выставка ''ВЫСШЕЕ ОБРАЗОВАНИЕ ДЛЯ ВАШИХ ДЕТЕЙ''

Russian-Japan Symposium on STOCHASTIC ANALYSIS OF THE ADVANCED STATISTICAL MODELS Joint RFBR-JSPS Russian-Japan Project "Complex Stochastic Models: Asymptotics and Applications" Co-leaders: A.Shiryaev and H.Wakaki Tuesday, September 15 9:30 Morning coffee 9:50 - 10:00 OPENING 10:00 - 10:40 H.WAKAKI. ... On a nonlinear minimax quickest detection problem for the Brownian motion 16:10 - 16:30 G.PERELMAN. ... Maximal inequality for skew Brownian motion 12:50 - 13:30 K.NISHIDE. ...

Еще в разделе: (Показать все результаты (>64) - new.math.msu.su/ )

... Issues of the year 2010 . ... Instructions for Authors . ... The scientific English language journal ‘GEOGRAPHY, ENVIRONMENT, SUSTAINABILITY’ aims at informing and covering the results of research and global achievements in the sphere of geography, environmental conservation and sustainable development in the changing world. ... In the text the surname of the author and the year of publication of the reference should be given in square brackets, i.e. [Author1, Author2, 2008]. ...

Еще в разделе: (Показать все результаты (>212) - www.geogr.msu.ru/ )

• Получение снимков Terra по Интернет

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf

МГУ имени М.В.Ломоносова Русская версия . ... International Conference for Students and Young Scientists "Lomonosov" . ... 29 Feb 2016 . ... The Chair academician Evgeny Ivanovich Moiseev . Secretary PhD student Evgeny Ivanovich Atamas . ... PhD Naumov A.A., PhD Salnikov A.N., PhD Senyukova O.V., PhD Smirnov I.N., PhD Stepanov S.V., PhD Kholomeeva A.A., DSc Shevtsova I.G., PhD Shupletsov M.S. The Chair academician Evgeny Ivanovich Moiseev . ... Secretary Evgeny Ivanovich Atamas (ссылка) . ...

Еще в разделе: (Показать все результаты (>18) - conf.msu.ru/ )

... Original Russian Text Copyright c 2001 by Grigoryan, Mailybaev On the Weierstrass Preparation Theorem S. S. Grigoryan and A. A. Mailybaev Received May 22, 2000 Abstract--An analytic function of several variables is considered. ... As an application, an explicit formula describing a bifurcation diagram locally up to second-order terms is derived for the case of a double root. Key words: Weierstrass preparation theorem, analytic function of several variables, bifurcation diagram. ... ЗЗЗ hn ! ...

Еще в разделе: (Показать все результаты (>31) - mailybaev.imec.msu.ru/ )

• http://mailybaev.imec.msu.ru/papers/Mailybaev2000.pdf
• http://mailybaev.imec.msu.ru/reviews/Olhoff.pdf

Выращивание лекарственных растений . Marina Rykhlikova 14 апреля 2003 11:48:40 . ... Проект по выращиванию редких лекарственных растений на садовых участках осуществлялся по гранту РОЛЛ и назывался "Дикие травы у нас дома". ... Адрес 241030, Брянск, ул.Репина, 16/61-93; . телефон (0832)446059; факс(0832)463673; . e-mail: root@erica.bryansk.ru . ...

Еще в разделе: (Показать все результаты (>27) - www.ecocoop.ru/ )

• Итак, список: в нем 1-10 - электронные, об 11 прочтешь, 12-19 - почтовые, почти
• ПРИЛОЖЕНИЕ 1

... Let the control system be given by the equation dx = X (x, u) = X, u U, dt where X is a vector field on the configuration space M , x M , u is the control parameter, U is the set of admissible values of u. With the vector field X we canonically associate a scalar-valued fiberwise linear function HX on the cotangent bundle T M , HX ( , u) = , X ( , u) , T M , u U, where : T M - M is the canonical pro jection. ...

Еще в разделе: (Показать все результаты (>15) - pont2008.cmc.msu.ru/ )

W. Hackbusch, B.N. Khoromskij, S. Sauter, and E. Tyrtyshnikov. Use of tensor formats in elliptic eigenvalue problems. Numerical Linear Algebra with Applications, 19(1):133-151, 2012. ... The results of numerical experiments clearly indicate the linear-logarithmic scaling of the low-rank tensor method in n. The algorithms work equally well for the computation of both minimal and maximal eigenvalues of the discrete elliptic operators . ...

Еще в разделе: (Показать все результаты (>60) - srcc.msu.ru/ )

• Lebedeva O. S. Tensor conjugate-gradient-type method for Rayleigh quotient

Пример документа из базы данных . ... ОБЛАСТИ ИССЛЕДОВАHИЯ: фундаментальные основы гомогенного, гетерогенного и ферментативного катализа; научные основы приготовления катализаторов; теоретические основы технологии каталитических процессов; разработка новых и усовершенствование существующих каталитических процессов, катализаторов и реакторов; автоматизация каталитических исследований. ...

Еще в разделе: (Показать все результаты (>131) - www.chem.msu.ru/ )

• ЛАБОРАТОРИЯ НЕОРГАНИЧЕСКОГО МАТЕРИАЛОВЕДЕНИЯ