... In addition to the direct effect of acidic solutions on tree crowns, resulting in tissue damage and leaching of metabolites, the acid impact modify soil properties, which is believed to be the most important in forest degradation. ... We assessed critical loads of acid deposition and their exceedance for forest soils in the European part of the former Soviet Union using a simple balance method and mapped them within 1.0°x0.5° longitude per latitude grid cells. ...

Еще в разделе: (Показать все результаты (>32) - eco.soil.msu.ru/ )

• Koptsik G.N., et al. Soils of the National Park "Russian North".
• ASSESSMENT OF SOIL SUSTAINABILITY TO ACID DEPOSITION

... Processing of pro-B-type natriuretic peptide: furin and corin as candidate convertases. ... BACKGROUND: B-type natriuretic peptide (BNP) and its N-terminal fragment (NT-proBNP) are the products of the enzyme-mediated cleavage of their precursor molecule, proBNP. ... We investigated the role of 2 candidate convertases, furin and corin, in human proBNP processing. ... CONCLUSIONS: Both furin and corin are involved in the proBNP processing pathway, giving rise to distinct BNP forms. ...

Еще в разделе: (Показать все результаты (>67) - biochem.bio.msu.ru/ )

• Human pro-B-type natriuretic peptide is processed in the circulation in a rat
• Processing of pro-brain natriuretic peptide is suppressed by O-glycosylation in
• Pinealon increases cell viability by suppression of free radical levels and

Submitted by the Eurasian Universities Association MEMORANDUM of the Eurasian University Ranking Conference (Moscow, 19 - 20 November 2009) Noting the important contribution of university ranking pioneers into initiating the process of higher education institutions ratings; stating the public significance of rankings and their influence on education development ; understanding the responsibility of ranking authors for the ... Convention on Rankings: Main Principles 1. ...

Еще в разделе: (Показать все результаты (>78) - www.msu.ru/ )

• Faculty of Global Processes
• Research Priorities in Sciences and Humanities at Moscow State University

1995, Biochemistry, 60, 8, 923-928. ... Basic server procedures are dedicated to homology (similarity) search of sequence and 3D structure of proteins. The homologies found could be used to build multiple alignments, predict protein and RNA secondary structure, and construct phylogenetic trees. In addition to traditional methods of sequence similarity search, the authors propose "non-matrix" (correlational) search. ... RNA Secondary Structure Prediction Based on Sequence Alignment . ...

Еще в разделе: (Показать все результаты (>198) - www.genebee.msu.ru/ )

• Импакт фактор научных журналов в 2003 году
• Notes on searching by similarity
• Multiple alignment

... Nonlinear optics of ionized mediums . Fiber lasers . ... Emergence of powerful laser systems, being able to deliver powerful ultrashort light pulses, allows one to investigate and exploit new class of nonlinear-optical phenomena, based on the media ionization, when the electrons are released by strong electromagnetic field directly or by collision of an atom with another electron accelerated in the field. ... Ultrafast optical switching of an ionized medium by interfering ultrashort laser pulses. ...

Еще в разделе: (Показать все результаты (>6) - photonicslab.phys.msu.ru/ )

... Interaction classes . ... List of Contact Types: . ... Contact with Major Groove of DNA by helices, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by strands, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by helices, loops . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by loops . ...

Еще в разделе: (Показать все результаты (>7) - npidb.belozersky.msu.ru/ )

... H: · 1 ­ Al2O3­Na3AlF6 (T - x) = 1 , ­ , ­ 1 ( ­ ); · 1 ­ Na2SO4­H2O (T - x) = 1 ( ); · 25° ( .. ... Na2SO4­H2O Na2SO4 10H2O, Na2SO4 + 10H2O Na2SO4 10H2O. , , , . ... 6, 7) LiBr KBr, , : L LiBr() + KBr() . ... 1) , , KBr. ... L. PbTe­SnTe PbSe­SnSe PbTe PbSe, , (.. ... BeF2­LiF , ( ), LiBeF3 Li2BeF4 BeF2­LiF (. ... LiBeF3 280°, BeF2 Li2BeF4 : LiBeF3 () ­ Na2SO4 7H2O: Na2SO4 + 7H2O Na2SO4 7H2O. : Na2SO4 7H2O() Na2SO4 10H2O() Na2SO4 () Na2SO4 () +L 24° BeF2 () + Li2BeF4 () . ... Na2SO4­H2O Na2SO4­H2O....

Еще в разделе: (Показать все результаты (>51) - www.inorg.chem.msu.ru/ )

• Inorganic Chemistry Division
• I n o r g a n i c C h e m i s
• Inorganic Synthesis Laboratory - Supramolecular and Cluster Compounds

... Магистерское образование . ... Магистерские программы . ... Магистерские программы (учебные планы) . ... Introduction to Cryptography . ... Basic requirements for data security in software systems. ... Lecturer: associate professor Primenko E. A. Mathematical Theory of Information . ... Addition operation of elliptic curve's points. f Postnikov's theorem.Theorems on the order of elliptic curve for certain types of primes. ... Магистратура: master@cmc.msu.ru, 3-й этаж, комната 360, тел. ...

Еще в разделе: (Показать все результаты (>18) - hcs.cmc.msu.ru/ )

• Master program "Mathematical and computer methods of image processing" |
• Master programљ"Decision Engineering in Economics and Finance" | Магистерское и
• Master program "Enterprise Information Systems" | Магистерское и послевузовское

... 7­8, 2000 UDC 620.18:65.012.12.001/002 REPRODUCIBILITY OF THE STRUCTURE AND PROPERTIES OF PARTS AND THEIR DESCRIPTION WITHIN THE FRAMEWORK OF NONLINEAR DYNAMICS A. Yu. ... The problem of the reproducibility of complex structures is discussed from the standpoint of the applied theory of dynamic systems. ... The problem of the reproducibility of complex structures that appear in nonlinear media has become closely connected with some problems of the applied theory of dynamic systems. ...

Еще в разделе: (Показать все результаты (>69) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/prokhorov/phd/phd.htm
• http://chaos.phys.msu.ru/loskutov/PDF/Inform_safety.pdf
• http://chaos.phys.msu.ru/loskutov/PDF/Boiph_Mironyuk_Los.pdf

ISSN 1560-3547, Regular and Chaotic Dynamics, 2015, Vol. ... 6 2015 SEQUENTIAL DYNAMICS IN THE MOTIF OF EXCITATORY COUPLED ELEMENTS 703 Then the system under study equation): 1 = = 2 3 = takes the following form (we deleted two multipliers from every (F (2 )+ F (3 ))1 (-1+2F (3 ) - 1 2 ), (F (3 )+ F (1 ))2 (-1+2F (1 ) - 2 2 ), (F (1 )+ F (2 ))3 (-1+2F (2 ) - 3 2 ). ... Vol. ... 6 2015 SEQUENTIAL DYNAMICS IN THE MOTIF OF EXCITATORY COUPLED ELEMENTS 709 function, the system takes the form (4.2). ...

Еще в разделе: (Показать все результаты (>114) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/336/170-statistical-irreversibility-of-the-kac-reversible-circular-model_en.pdf

Histone-like proteins from archaea beta-Glucosyltransferase (DNA-modifying) C-terminal domain of RNA polymerase alpha subunit CAP C-terminal domain -like DNA repair glycosylase, 2 C-terminal domains DNA repair protein MutS, domain I DNA-binding protein LAG-1 (CSL) DNA-binding protein LAG-1 (CSL) Endonuclease III Group I mobile intron endonuclease Intein ( protein splicing domain ) Intein ... Restriction endonuclease-like . ... Restriction endonuclease PvuII . ...

Еще в разделе: (Показать все результаты (>311) - monkey.belozersky.msu.ru/ )

• SCOP famyli: Restriction endonuclease FokI, C-terminal (catalytic) domain
• SCOP famyli: Restriction endonuclease BamHI
• SCOP famyli: Restriction endonuclease BglII

... Geography of World Economy . ... Recreational Geography and International Tourism . ... Physical Geography and Landscape Science . ... Field stations . ... Educational council . Science . ... International commission on continental erosion . ... Field training . ... Type of field courses . ... Interuniversity council for erosion and fluvial.. ... International programme in Natural Resource Management and Law offers a unique combination of Natural and Environmental Sciences and Science of Law. ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• THE MAKKAVEEV LABORATORY OF SOIL EROSION AND FLUVIAL PROCESSES
• Department of Land Hydrology
• Department of Meteorology and Climatology

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>22) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

... Publications . ... SPDC Laboratory . Quantum Electronics Chair . ... Error: You currently have Javascript disabled. ... On the passive probing of fiber optic quantum communication channels?, ... Such a backward emission can present a potential serious problem for the stability of fiber optic quantum cryptography systems against passive probing. ... Download [ help ]: . ... All persons copying this information are expected to adhere to the terms and constraints invoked by each author's copyright. ...

Еще в разделе: (Показать все результаты (>131) - qi.phys.msu.ru/ )

• Directions :: Quantum Information Laboratory

... David Kirk/NVIDIA and Wen-mei W. Hwu , 2007-2012 ECE408/CS483, University of Illinois , Urbana-Champaign 14 CUDA Device Memory Management API functions · cudaMalloc() ­ Allocates object in the device global memory ­ Two parameters · Address of a pointer to the allocated object · Size of of allocated object in terms of bytes ( Device ) Grid Block (0, 0) Block (0, 1) Registers Registers Registers Registers · cudaFree() ­ Frees object from ...

Еще в разделе: (Показать все результаты (>5) - ccoe.msu.ru/ )

The Self-Organization of the Cellular Environment and the Reproduction of the Network Logical Structure M.V. Medvedeva, V.A. Koloskov, State Technical University, Kursk, Russia mariya_medvedeva@hotmail.com Keywords: fault tolerance, multicontroller network, recovery from faults, parallel distributed computations, cellular algorithm, backup copies. ... The graph [pic] describes the quality characteristics of the recustomizing routes from the faults' location to the backup nodes. ... M, [pic] j ( 1,2,.. ...

Еще в разделе: (Показать все результаты (>64) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/kolbasova/acat.pdf
• http://acat02.sinp.msu.ru/presentations/litinski/litinski.doc
• http://acat02.sinp.msu.ru/presentations/ivanchenko/iv.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>21) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Alignment example
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

Еще в разделе: (Показать все результаты (>2) - saistud.sai.msu.ru/ )

• Times of minima(maxima) calculator

... A+B A+B* A+B A++B+eA+B+ A*+B AB+C AB+C elastic scattering excitation de-excitation ionization (electron loss) charge transfer (electron capture and loss) transfer of excitation re-arrangement reaction Often these processes are studied by observing collisions of atoms or ions with dilute gases. ... It is to be expected that the electronic excitations during atomic collisions in a solid differ in many details from those in a gas, because the electronic structure of the embedded atoms is different. ...

Еще в разделе: (Показать все результаты (>107) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/Articles_GSIB/nimb206_830_GCIB_Applications_Equipment.pdf
• http://danp.sinp.msu.ru/LIIWM/JPhysD33_2000_3152Kulikauskas.pdf
• http://danp.sinp.msu.ru/LAS/Teplova05.pdf