... Landau 2000). ... Move debate on control by introducing a new observation about PC into adjuncts clauses, or rather its specific subspecies that I call Parasitic PC effects (PPCE). The PPCE arise once adjunct control is coupled with PC in a complement clause. ... First, the coupling of PC readings in adjunct clauses with PC effects in the complement clause points to the OC status of adjunct control, contra Landau. ... Agreement and flotation in Partial and Inverse Partial Control Configurations. ...

Еще в разделе: (Показать все результаты (>285) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~smu/work/science-day/2011/33.pdf
• http://www.philol.msu.ru/~otipl/new/main/people/kibrik-aa/files/Communicative_intentions@Odessa_2008.pdf
• http://www.philol.msu.ru/~otipl/new/fdsl/abstracts/jablonska.pdf

Prediction of physical properties of materials based only on their chemical composition has long been an intriguing task. ... The main interests of Prof. Lebedev 's group are physical properties of crystals exhibiting structural instability, in which different phase transitions (including the ferroelectric one) can appear. ... A.I. Lebedev. ... Physics of the Solid State 51 , 362 (2009) ; e-print arXiv:1305.0240 (2013) ; [local copy] . ... Physics of the Solid State 51 , 2324 (2009) ; [local copy] . ...

Еще в разделе: (Показать все результаты (>59) - scon155.phys.msu.su/ )

... Acoustic Nonlinearity, Attenuation and Scattering of a Sound in Water with Vapor-Gas Bubbles . ... Nonlinear effects, attenuation and scattering of a sound, originated in propagating of a sound in a liquid with vapor-gas bubbles, are investigated. A liquid with phase inclusions near to phase transition represents an example of complex media, when at determination of the acoustic characteristics it should take into account phase transformations. ...

Еще в разделе: (Показать все результаты (>156) - acs366.phys.msu.su/ )

• Abstract (Invited)

... Opening of the educational programme - School of CEOs, "Capsule of security" for the key managers of Bashneft Group. ... April 11, 2013 - Bashneft Group in conjunction with JSFC "Sistema" opened the programme for the development of key Bashneft Group management - School of CEOs, "Capsule of security". ... At the end of his Welcoming Speech President of Bashneft Group stressed that this programme ? ... The School of CEOs ? ... 2006-2016 MSU Higher School of Management and Innovation. ...

Еще в разделе: (Показать все результаты (>9) - hsmi.msu.ru/ )

Beneficial Effects of the Complex Humic Microfertilizer Applied to the Ornamental Plum Hessei Olga S. Bezuglova1, Irina V. Perminova2, N.M. Neganova 1 2 1 South Federal University, Rostov-on Don, Russia, besuglova@bio.rsu.ru Lomonosov Moscow State University, Department of Chemistry, 1119992 Moscow, Russia Keywords: complex microfertilizer, humic, plum Hessei, beneficial effects 1. ... Two years old plants of plum Hessei grown on the common carbonate chernozem were used in these experiments. ...

Еще в разделе: (Показать все результаты (>146) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/arw/database-sheet.doc
• http://www.mgumus.chem.msu.ru/publication/2008/2008-kholodov-retention.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... Following the approach of Daly [1], this paper introduces several algorithm improvements allowing for more accurate calculation of threshold elevation and modeling of the facilitation effect during phase-coherent masking. ... Section 3 introduces the Complex Cortex Transform (CCT) and its computation algorithm. ... CCT cc (9) 4. 4.1 USING CCT FOR MODELING OF MASKING Modeling Threshold Elevation Using CCT Magnitude 3.4 Properties of the Complex Cortex Transform 1. ...

Еще в разделе: (Показать все результаты (>158) - imaging.cmc.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2008.cyprus.yurin.plf.en.pdf
• Software projects | Laboratory of Mathematical Methods of Image Processing
• View publication | Laboratory of Mathematical Methods of Image Processing

CLAS12 .. E-mail: rogozhin@silab.sinp.msu.ru This paper describes the upgrade of the CLAS12 detector complex at Thomas Jefferson National Accelerator Facility. ... The detector complex is described and the role of the Silicon Vertex Tracker is mentioned. ... CLAS12[1,2] (CEBAF Acceptance Spectrometer at 12 GeV) . ... CLAS12 CLAS12 (. ... FSSR2 , CEBAF. ... Pre-Conceptual Design Report for the Science and Experimental Equipment for the 12 GeV Upgrade of CEBAF. Jefferson Lab ґ June 11, 2004. ...

Еще в разделе: (Показать все результаты (>142) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/conf/XFEL/XFEL-TDR_Chapter09_Project%20Management.pdf
• http://nuclphys.sinp.msu.ru/conf/XFEL/XFEL-TDR_Chapter10_Cost-Time%20Schedule.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/240809/TristanDuPree.pdf

SITE 2010 Comprehensive Characterization of Astronomical Sites Kislovodsk, Russia, 49 October 2010 Conference Summary Marc S. Sarazin*a a European Southern Observatory, Garching, Germany Abstract The main topics discussed during the Site 2010 conference are outlined and the outcome is described. Keywords: Astronomical Site testing, precipitable water vapor, atmospheric turbulence, cloudiness, seeing 1. ... Site surveys for National observatory projects in China, India, and Iran benefit from this. ...

Еще в разделе: (Показать все результаты (>18) - site2010.sai.msu.ru/ )

• Methods and instruments to measure/monitor major site properties

... Ariskin A.A., Bouadze K.V., Meshalkin S.S., Tsekhonya T.I. (1992) INFOREX: A database on experimental studies of phase relations in silicate systems. ... Meshalkin S.S., Ariskin A.A., Barmina G.S., Nikolaev G.S., Almeev R.R. (1996) Development of a database on experimental crystal-melt equilibria for igneous rocks: INFOREX system, version-3.0. ... Meshalkin S.S., Ariskin A.A. (1996) INFOREX-3.0: A database on experimental phase equilibria in igneous rocks and synthetic systems. ...

Еще в разделе: (Показать все результаты (>642) - geo.web.ru/ )

• http://geo.web.ru/~ariskin/docs/papers/a_2010_adelaide_bychkov.pdf
• COMAGMAT MODEL
• Второе приглашение на научно-практическую конференцию "Современные методы

... Rs485 driver . ... http://dragon.sai.msu.ru/mass/download/rpm/suse/8.2/yast-source for SuSE Linux 8.2 . ... SuSE Linux 8.2 . ... Download . Size . Type . ... Rs485 . ... Red Hat Linux 9.0 . ...

Еще в разделе: (Показать все результаты (>24) - curl.sai.msu.ru/ )

COLLABORATIVE OPEN OBJECT LEARNING ENVIRONMENT Dr. Colin B. Price (United Kingdom, Worcester) We have recently developed Java applications which can be deployed on the Internet to provide collaborative learning between students and tutors at remote locations. Students can engage in group activities online and collaborate with tutors in a Distance Learning mode. ... The third application consists of collaborative building and simulation of nonlinear differential equations. ...

Еще в разделе: (Показать все результаты (>250) - www.mce.biophys.msu.ru/ )

• MCE-2016

... Oligomeric adiponectin forms and their complexes in the blood of healthy donors and patients with type 2 diabetes mellitus. ... Adiponectin (Adn) is a protein that circulates in the blood in several oligomeric forms, namely low-, medium-, and high-molecular-weight forms. ... A decrease in the total Adn and Adn-albumin complex levels in the blood of patients with T2DM and no difference in the levels of the Adn-C1q complex in comparison with healthy volunteers were demonstrated. ...

Еще в разделе: (Показать все результаты (>73) - biochem.bio.msu.ru/ )

• Reversible dissociation of flavin mononucleotide from the mammalian
• Heterooligomeric complexes formed by human small heat shock proteins HspB1
• Oxidative stress induced in rat brain by a combination of 3-nitropropionic acid

Space Weather . ... Models . Data . ... Space Weather Analysis Centre of SINP MSU provides information about the current state of near-Earth's space. Information Services ( SWX ) on the website of the center provide access to current data describing the level of solar activity, geomagnetic and radiation state of the magnetosphere and the heliosphere in the real time. For data analysis, the models of the space environment, working in off-line as well as on-line mode have been implemented. ...

Еще в разделе: (Показать все результаты (>6) - swx.sinp.msu.ru/ )

All your comments please send to Yagola Anatoly ( yagola@prof.msu.ru ) or to web-deseigners of the site ( ill-posed@mail.ru , nataschka_@mail.ru ).

Еще в разделе: (Показать все результаты (>20) - foroff.phys.msu.ru/ )

• Postdoctoral training (Cosmic Rays and Physics of Space)

. Загружено: Vovez . Дата загрузки: 05.03.2010 . Размер: 77.6 Кбайт . Подпись: no comments . Описание: ...

Еще в разделе: (Показать все результаты (>5) - www.dubinushka.ru/ )

. I n o r g a n i c C h e m i s t r y D i v i s i o n . About/history Contacts Administration Education Staff . Laboratories: . Inorganic Materials Sciences . Chemistry of Coordination Compounds . Chemistry and Physics of Sensor and Semiconductor Materials . Inorganic Synthesis . Inorganic Crystallochemistry . 24-th of September 2010. V.A. Aleshin on his Dr of Sci. consil . Describing complex P-T-x diagram . Are you happy? . mail us home page russian version

Еще в разделе: (Показать все результаты (>57) - www.inorg.chem.msu.ru/ )

• Group of Hydrothermal Synthesis :: Scientific Interests

Diploma thesis abstract "Pulse Terahertz Spectroscopy of complex Molecules" Smirnova I. N. Some of the vibration frequencies of molecular crystals lie in terahertz range. ... In present work the technique of pulse terahertz spectroscopy is used, to obtain absorption spectra in farinfrared region 10-110 cm-1. The influence of molecular and crystal structure on absorption spectra of molecular crystals is investigated by the example of some amino acids and polypeptides. ...

Еще в разделе: (Показать все результаты (>91) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2013/Kashtanov_Zapunidi_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2012/Mankova_Chikishev_Shkurinov_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2008/Vlasov_Paraschuk_en.pdf

... Like ordinary make, metamake keeps platform-dependent files (object, executables, libraries) for repeated usage. To use the metamake, one must define basic project directories (task directory, target root, object directory etc) and prepare two simple files: task-file that contains common project settings (selected compilers, common system libraries etc) and architecture- independent Imake-file which includes project description along with compiler and linker directives. ...

Еще в разделе: (Показать все результаты (>70) - acat02.sinp.msu.ru/ )

• http://acat02.sinp.msu.ru/presentations/brun/Exercises_2.doc
• http://acat02.sinp.msu.ru/presentations/tuura/userguide.pdf
• http://acat02.sinp.msu.ru/tut1.html

The Octotron Approach: Towards Autonomous and Reliable Operation of Supercomputers Alexander Antonov, Dmitry Nikitenko, Pavel Shvets, Sergey Sobolev, Konstantin Stefanov, Vadim Voevodin, Vladimir Voevodin, Sergey Zhumatiy Research Computing Center, Lomonosov Moscow State University, Moscow, Russia {asa,dan,shpavel,sergeys,cstef,vadim,voevodin,serg}@parallel.ru 1 Introduction ... 2 The Octotron System: Model-based Approach Octotron represents the supercomputer model in the form of a graph (Fig. ...

Еще в разделе: (Показать все результаты (>43) - hpc.msu.ru/ )

• APPLICATIONS: Physical Chemistry | Moscow University Supercomputing Center