... List of complexes . List of structures of RNA-protein and DNA-protein complexes . ... Experimental method: all X-RAY DIFFRACTION SOLUTION NMR ELECTRON MICROSCOPY FIBER DIFFRACTION SOLUTION NMR; THEORETICAL MODEL SOLUTION NMR; SOLUTION SCATTERING . Kind: all rna dna hybrid . ... HYDROLASE/DNA . X-RAY DIFFRACTION . ... dna . ... RNA BINDING PROTEIN/RNA . ... rna . ... HYDROLASE/RNA/DNA . ... HYDROLASE/RNA . ... TRANSFERASE/RNA/DNA . ... TRANSFERASE/DNA/RNA . ... NPIDB team 2003 - 2016 . ...

Еще в разделе: (Показать все результаты (>3) - npidb.belozersky.msu.ru/ )

• NPIDB: Home

... Length = 4702289 Score = 751 bits (1939), Expect = 0.0 Identities = 359/457 (78%), Positives = 409/457 (89%) Frame = -2 Query : 1 MSVQQIDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAVARYPERPLSLYVHIP 60 MS I WDL+LIQKYNYSGPRYTSYPTALEFSED+ E AF QAV RYP+RPLSLYVHIP Sbjct : 3930889 MSEHAIVWDLSLIQKYNYSGPRYTSYPTALEFSEDYNESAFQQAVKRYPQRPLSLYVHIP 3930710 ...

Еще в разделе: (Показать все результаты (>7742) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/~element/Term3/blast_3.txt
• http://kodomo.fbb.msu.ru/~element/Term3/pm.txt
• Alex Makarov. Personal Page. Homologs search.

... Research . ... Staff . ... PhD . ... Head of Laboratory, . Professor, Doctor (chem. sci.) ... PhD, senior researcher . ... Dr. (tech. sci.), prinsipalљresearcher . ... PhD, juniorљresearcher . ... Dr. (tech. sci.), principalљresearcher . ... PhD, principalљresearcher . ... Dr. (chem. sci.), principalљresearcher . ... Colloquium on 24.12.12 20 Dec 2012 . ... Colloquium on 23.11.12 22 Nov 2012 . ... Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>92) - td.chem.msu.ru/ )

• Our Partners Laboratory of Chemical Thermodynamics
• Carbamide Laboratory of Chemical Thermodynamics
• Colloquium on 09.11.12 Laboratory of Chemical Thermodynamics

... Number of required sensors is 10000 4 The part of ANTARES collaboration (http://antares.in2p3.fr/Collaboration/index.html) 5 The some direction of MSU group activity in the project · Bioluminescence cut · Quality cuts · SN search 6 Bioluminescence cut We have collected distributions of hit counts for each PMT during one K40 run (~45min) Usually these distributions consist of 2 parts ­ Poissonian (due to K40 and plankton ... Conclusion Bioluminescence cut was done. ...

Еще в разделе: (Показать все результаты (>23) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/seminar/Kulikovskiy.pdf
• http://antares.sinp.msu.ru/docs/rasp.doc

... People . ... Introduction to quantum physics . ... Contacts . ... Professor . Contact . ... Associate Professor . ... Leading Researcher . ... Senior Researcher . ... Research Associate . ... Research Assistant . ... 2003 2016 Department of Quantum Electronics . ...

Еще в разделе: (Показать все результаты (>45) - quantum.phys.msu.ru/ )

• SPDC Laboratory | Department of Quantum Electronics
• Theory | Department of Quantum Electronics

... разместить резюме Suwon (South Korea) . ... Описание вакансии: . Samsung SDI Research Development Centre in Suwon (South Korea) is looking for scientist specialized in TEM. Research mainly deals with materials for Li batteries and less with other power sources like solar or fuel cells. The candidate must have good skill in TEM and related analytic tools including traditional (ED, HREM, EDX) and modern techniques (STEM-HADDF, EELS etc.) and crystallography. ... следующая вакансия . ...

Еще в разделе: (Показать все результаты (>37) - www.chemport.ru/ )

. Creation of this service is supported by the Russian Foundation of Basic Research, grant 03-07-90157 Preparing results. Please wait ...

Еще в разделе: (Показать все результаты (>71) - monkey.belozersky.msu.ru/ )

• Search for potential water bridges between protein and nucleic acid
• Hydrophobic clusters

. Секция «Солнце» . Предварительная повестка дня . Пятница,   29 мая . 14:00–14:15 А. И. Подгорный, И.М. Подгорный.   Солнечная вспышки – модель и сравнение с наблюдениями. 14:15–14:30   Ю .В. Думин , Б.В. Сомов. Топологическое инициирование быстрого магнитного пересоединения . 14:30–14:45 П.А.   Грицык ,   Б.В. Сомов. Модель толстой мишени с обратным током и современные наблюдения солнечных вспышек. 14:45–15:00 Н.П.   Колесников, С.И. Безродных, Б.В. Сомов. Расчет течений плазмы в приближении сильного

Еще в разделе: (Показать все результаты (>114) - sai.msu.ru/ )

• MERAC Prizes for young European astronomers — new deadline for applications
• Home page of Dr. N.N.Samus

... Kornev, V., Sharafiev, A., Kolotinskiy, N., and Mukhanov, O. Microwave dynamics of superconducting quantum cell.љ ... DOI љ] . ... Kornev, V., Sharafiev, A., Soloviev, I., and Mukhanov, O. Signal and noise characteristics of bi-squid.љ ... Kornev, V., Sharafiev, A., Soloviev, I., Kolotinskiy, N., Skripka, V., and Mukhanov, O. Superconducting quantum arrays.љ ... Kornev, V., Sharafiev, A., Soloviev, I., Kolotinskiy, N., and Mukhanov, O. Superconducting quantum arrays for broadband rf systems.љ ...

Еще в разделе: (Показать все результаты (>22) - cryolab.phys.msu.ru/ )

• Nikolay V. Kolotinskiy
• Staff
• Devices based on LTS and HTS

Nhunt: solving the low complexity problem for nucleic acid homology search Yury Pekov1, Kirill Romanenkov2, Alexey Salnikov2, Sergei Spirin 1 3 3 Faculty of Bioengineering and Bioinformatics, 2Faculty of Computational Mathematics and Cybernetics, and Belozersky Institute of Physico-Chemical Biology, Moscow State University. E-mail: sas@belozersky.msu.ru We introduce Nhunt, a program for sensitive nucleic acid homology search. ... The compositional adjustment of amino acid susbstitution matrices. ...

Еще в разделе: (Показать все результаты (>284) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/49.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/36.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/154.pdf

... Lomonosov Moscow State Univ Research Center "Computer Science and Control" of RAS (FRC CSC RAS) Operations Research Society (RSORS) will organize the VIII Conference in Octo Operations Research. theoretical aspects and ersity (MSU), Federal and Russian Scientific ber 2016 in Moscow. ... Deadline for abstract submissions is March 31, 2016. ... Conference website: http://io.cs.msu.ru/ORM2016.html. ... Selected extended abstracts will be published in the Conference proceedings. ...

Еще в разделе: (Показать все результаты (>24) - io.cmc.msu.ru/ )

• http://io.cs.msu.ru/ORM2016/ORM2016-2nd_announ-ENG.pdf

Cascade Search: Stability of Reachable Limit Points / Fomenko T.N. // Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>79) - vestnik.math.msu.su/ )

... 7 (495) 939-16-82 info@physics.msu.ru . ... Japan), and Univ. of Oulu (Finland) demonstrated that a power-law size distribution with large-size cutoff, as observed in Saturn's rings, is universal for systems where a balance between aggregation and disruptive collisions is steadily sustained. ... We show that a power-law size distribution with large-size cutoff, as observed in Saturn's rings, is universal for systems where a balance between aggregation and disruptive collisions is steadily sustained....

Еще в разделе: (Показать все результаты (>359) - phys.msu.ru/ )

• Faculty Staff
• Faculty of Physics
• Graduate and Doctoral Study at the Faculty of Physics

... Новости . Объявления . Контакты . ... Расписание . О кафедре . ... на кафедру . ... ВМК . МГУ . ... СМУ ВМК . Расписание экзаменов 415 группы. ... Кафедра системного анализа ВМК МГУ создана в 1992 году. Организатор и заведующий кафедрой - лауреат Ленинской премии, заслуженный профессор МГУ, академик РАН Александр Борисович Куржанский . ...

Еще в разделе: (Показать все результаты (>4) - sa.cmc.msu.ru/ )

• Выпускники | Кафедра системного анализа ВМК МГУ
• Сотрудники кафедры | Кафедра системного анализа ВМК МГУ
• Send page by email | Кафедра системного анализа ВМК МГУ

A GENETIC ALGORHYTM FOR OPTIMIZING A NEURAL NETWORK CAPABLE TO LEARN FOR FOOD SEARCHING IN A RADIAL MAZE Budilova E.V., Chepurnova N.E., Chepurnov S.A, Teriokhin A.T. M.V.Lomonosov Moscow State University, Dept. of Biology. ... The upper platform has a hole in the middle and several radially directed tubular canals ("arms") each of which can contain a peace of food and has doors opening only in the centrifugal direction. ... The task of the animal is to visit only those arms which contain food. ...

Еще в разделе: (Показать все результаты (>39) - ecology.genebee.msu.ru/ )

J/AstL/vol/page SAI Open Clusters Catalog (Glushkova+, 2009) ================================================================================ Automated search for star clusters in large multiband surveys. ... Color excesses E(B-V), distance moduli and ages were determined for 141 new and 27 known, but poorly studied clusters. We present the Sternberg Astronomical Institute Open Clusters Catalog (SAI OCL Catalog) of coordinates, diameters and main physical parameters of these clusters. ...

Еще в разделе: (Показать все результаты (>4) - ocl.sai.msu.ru/ )

• SAI Open Star Clusters (SAI OCL) Catalog
• SAI OCL Catalog Publications

... Any - Head of the Department Deputy Head of the Department Scientific Secretary Secretary Professor Docent Senior Lecturer Assistant Professor Senior Researcher Researcher Junior Researcher . ... 119992 Moscow, GSP-1, Leninskie Gory, MSU, mechanics and mathematics department, OPU, Room 13-14 . ...

Еще в разделе: (Показать все результаты (>102) - new.math.msu.su/ )

• Andrei Vladimirovich Fursikov | Department: General Problems of Control.
• Classes | Department: General Problems of Control. Faculty of Mechanics and
• Photo galeries list | Department: General Problems of Control. Faculty of

... KEY WORDS: North Siberian vole, Microtus hyperboreus, distribution, North East Asia, Chukotka. ... The North Siberian vole (Microtus hyperboreus Vinogradov, 1933) remains till now a least investigated mammal species in North East Asia. ... Until recently in the Chukotskii Autonomnyi Okrug (Chukchi Autonomous District) North Siberian vole was collected only in its extremely western limits in Omolon River basin (Chernyavski et al., ... Relative density of North Siberian vole here was 10%. ...

Еще в разделе: (Показать все результаты (>1680) - zmmu.msu.ru/ )

• Section staff
• Present distribution of Pipistrellus kuhlii in the Volga region

Обсуждается модель, описывающая поиск цели белками на ДНК, основанная на уравнениях с дробными производными. ... Вводится определение эффективности поиска, позволяющее сравнивать различные стратегии поиска, в том числе и для Леви полетов в потенциале. На основе аналических, численных данных и результатах Монте-Карло моделирования показано, что, как броуновское движение, так и Леви полеты, могут являются наиболее удачными стратегиями, в зависимости от параметров задачи. ...

Еще в разделе: (Показать все результаты (>241) - polly.phys.msu.ru/ )

• Elena P. Kharitonova
• CV of Tatiana Burova
• index

... Siberian Lang . Minority languages of Siberia as our cultural heritage . ... The project ?Development of the web-site ?Minority languages of Siberia as our cultural heritage? (on the material of the languages of the basin Middle Yenisei and the Middle and the Upper Taz)? was realized at the Laboratory for Computational Lexicography, Research Computing Centre, Lomonosov Moscow State University, with financial support from Russian Foundation for the Humanities, grant 12-04-12049.љ ...

Еще в разделе: (Показать все результаты (>3) - siberian-lang.srcc.msu.ru/ )

• Language games | Siberian Lang
• Siberian Lang | Minority languages of Siberia as our cultural heritage