... Initiation of Destructive Strike Acoustic Wave in the Liquid of the Big Volume at the Temperature Near to Boiling Point . ... Let, in the closed reservoir not completely filled by liquid at the temperature near to boiling point, the pressure decreases quickly. Here, the temperature of liquid boiling decreases also quickly and if it is less than original liquid temperature, the part of the internal energy will be expended for vapor formation. ...

Еще в разделе: (Показать все результаты (>102) - acs366.phys.msu.su/ )

• ISNA-16

... About CIE MSU . ... Student's Life . ... Vestnik CIE (in Russian) . ... About Moscow University . ... Life . ... Students life in personal extracts presented to us by one of our students. A Normal Day, 30 Nov 2004, 11.20pm (Moscow time) . ... Since school always begins at 10am, my alarm-clock starts its attempts to wake me at 08.40am. ... But to get in time to the university I cannot sleep more then these ten extra minutes. ... As usual, I try to make all morning routines as regular as possible. ...

Еще в разделе: (Показать все результаты (>73) - www.cie.ru/ )

• Cultural Programmes and Excursions :: Academic Programmes :: CIE
• Apply Online
• Russian Language Programmes :: Academic Programmes :: CIE

... It can be applied to the studies of not only crystalline solids, but also to studies of various disordered, nanocrystalline, amorphous and liquid systems. In our laboratory we use EXAFS to study the local environment of isovalent and nonisovalent impurities in narrow-gap IV-VI semiconductors with a particular emphasis to off-center impurities which can induce the ferroelectric phase transition in these crystals. ... A.I. Lebedev, I.A. Sluchinskaya, V.N. Demin and I.H. Munro. ...

Еще в разделе: (Показать все результаты (>28) - scon155.phys.msu.su/ )

• Low-temperature phase transitions in some quaternary solid solutions of IV-VI

... PyMol is a powerful drawing instrument and here we show how to plot Fukui function with PyMOL after two calculation steps with FireFly (PC-GAMESS). ... Because total HOMO orbital have two electrons and should be divided by two (see equations at the beginning). 1 комментарий " Building and plotting Fukui function with FireFly and PyMol " . Quantum chemistry information page ERG Research Group: Лаборатория теоретической биофизики написал (Май 20th, 2015 12:43 пп) . ... 2014 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>55) - erg.biophys.msu.ru/ )

• pymol ERG Research Group: Лаборатория теоретической биофизики

... About the park-museum "Kolomenskoye" Kolomenskoye is a nice park and a former royal estate situated several kilometers to the southeast of the city center of Moscow, on the ancient road leading to the ancient picturesque town of Kolomna (hence the name). ... The estate was one of the favourite places for Ivan the Terrible. ... In XVI-XVII centuries there develops a unique architectural ensemble, subordinated to the idea of ceremonial royal residence, which is of great artistic and historical value. ...

Еще в разделе: (Показать все результаты (>2) - math.phys.msu.ru/ )

Lomonosov Moscow State University Biological faculty Botanical garden (Russia) (http://botsad.msu.ru/eng_news.htm) Botanical garden of the Komarov Botanical institute (Russia) Russian Iris Society Botanical garden of Taurida National Vernadsky University (Ukraine) The second information message Dear colleagues! ... Educational and enlightening activities based on collections of genus Iris L. The program of the Symposium will consist of plenary and sectional sessions as well as poster presentations. ...

Еще в разделе: (Показать все результаты (>12) - botsad.msu.ru/ )

• Botanical garden of Lomonosov Moscow State University

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>75) - www.genebee.msu.ru/ )

• MUSCLE 3.6
• AliGraf - GeneBee Graphical Alignment Help
• Picornaviruses: discovering big in small

... Manuscripts are classified in size into the three categories: . ... The most stringent requirements are imposed on manuscripts of the first category. ... Manuscripts of the second category should contain a representation of main results without excessive details in conclusions and proofs. ... Manuscripts should be prepared in electronic form using LaTeX 2.09 (see the instructions for manuscript preparation in electronic form) . ... The manuscript should be signed by its author(s). ...

Еще в разделе: (Показать все результаты (>17) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник

... Faculty of Basic Medicine, Lomonosov Moscow State University and State Research Center ­ Institute for Biomedical Problems, Russian Academy of Science invite you to take part in "VI Russian National School with International Participation on Muscle and Exercise Physiology "Systemic and cellular mechanisms in physiology of motor system". ... We invite scientists, post-grade students, residents and students to take part in School on systemic and cellular mechanisms in physiology of motor system. ...

Еще в разделе: (Показать все результаты (>9) - fbm.msu.ru/ )

... Write {{ note text }} anywhere in a topic. ... FOOTNOTE{LIST="Web.Topic"}% will be replaced by the notes from an %INCLUDE% ed page. ... Tim Berners-Lee{{Tim Berners-Lee is now director of the World Wide Web Consortium, and Professor of Computer Science at Southampton ECS.}} invented the World Wide Web. ... Tim Berners-Lee (1) invented the World Wide Web. ... Notes 1 : Tim Berners-Lee is now director of the World Wide Web Consortium, and Professor of Computer Science at Southampton ECS. ...

Еще в разделе: (Показать все результаты (>1850) - wiki.cs.msu.ru/ )

• (backlinks in System Web) VarSTARTSECTION < System < Foswiki
• (backlinks in all Webs) VarSTARTSECTION < System < Foswiki
• (more) VarVARCACHE < System < Foswiki

... The students of the Faculty of Geography study territorial distribution and spatial development patterns of various natural phenomena as well as social and economic objects. ... The academic program includes courses with lectures, seminars, laboratory and field training in natural sciences and humanities which form 4 blocks: . ... In addition to the field stations of the Faculty, the students have an opportunity to have their field training in scientific institutions and different companies. ...

Еще в разделе: (Показать все результаты (>5) - www.eng.geogr.msu.ru/ )

• Postgraduate study

Alexander Dmitrievich Ryabov . ... Place of Birth: Moscow, Russia (USSR) . Higher Education - Department of Chemistry, Moscow State University, Russia . ... 1976 - Graduated the Department of Chemistry, Moscow State University . ... Professor of Chemistry, Division of Chemistry, G. V. Plekhanov Russian Economic Academy, Moscow, Russia; February 1989 -; Professor of Chemistry, Division of Chemical Enzymology, Department of Chemistry, Moscow State University; Moscow, Russia; September 1993 - . ...

Еще в разделе: (Показать все результаты (>68) - www.enzyme.chem.msu.ru/ )

• Raeva A.A.
• Azizov R.E.
• Stepanov N.A.

. This text will be replaced

Еще в разделе: (Показать все результаты (>12) - polit.msu.ru/ )

• Untitled Document

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . PhD student Ekaterina A. Makeeva . ... One of the winners of 3 rd All-Russian Nanotechnology Internet Olympiad "Nanotechnology - breakthrough to the Future!" (2009), and also places in subject sections: nanochemistry (1st place), nanobiotechnology (1st place), structural materials (2nd place), nanomaterials (3rd place). ... 2008-2010 The Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>9) - www.lssm.inorg.chem.msu.ru/ )

XMCQDPT (Extended Multi-Configuration Quasi-Degenerate Perturbation Theory) is the new approach to Multi-State Multi-Reference Petrurbation Theory developed by Dr. Alexander A. Granovsky of Firefly Proejct. ... XMCQDPT2 (XMCQDPT at second order of PT expansion, referred as MC-XQDPT2 in some older publications) is superior to MCQDPT2 and is aimed to completely replace MCQDPT2/DETPT2 calculations in the future. ... Fast Two-electron Integral Code . ... PC GAMESS/Firefly' NBO code . ...

Еще в разделе: (Показать все результаты (>33) - classic.chem.msu.su/ )

Sergei Kulik . ... Department of Quantum Electronics, Faculty of Physics, M.V.Lomonosov Moscow State University, Leninskie gory, 1, str.2, Moscow 119992, GSP-2, Russia, . ... 1986 Graduated from M.V.Lomonosov Moscow State University; . 1991 Ph.D. in M.V.Lomonosov Moscow State University; . ... 2006 - M.V.Lomonosov Moscow State University, . Department of Quantum Electronics, Faculty of Physics, Head of Quantum Information lab . 2003 - M.V.Lomonosov Moscow State University, . ...

Еще в разделе: (Показать все результаты (>60) - qi.phys.msu.ru/ )

... PhD student, Physics Department, M.V.Lomonosov Moscow State University . ... International Laser Center and Faculty of Physics . M.V.Lomonosov Moscow State University . Moscow 119899 . ... 2016 Quantum Information Laboratory. ...

Еще в разделе: (Показать все результаты (>57) - qilab.phys.msu.ru/ )

... Brazilian Journal of Microbiology [Braz J Microbiol] . Common information . ... since 2000-01-01 till today . ... biology ->microbiology . ... Replacing the Revista de Microbiologia . ... Sociedade Brasileira De Microbiologia . ... http://www.scielo.br/scielo.php?scrip.. ... 2000-01-01 . today . ...

Еще в разделе: (Показать все результаты (>35) - journals.genebee.msu.ru/ )

. Previous Next Galleries . Sometimes our group meeting takes place outside the University :-) . Previous Next Galleries

Еще в разделе: (Показать все результаты (>10) - www.inorg.chem.msu.ru/ )

... Geometry, Topology, Integrable Systems . International conference in honour of Sergey Novikov on the occasion of his 75th birthday . New! Moscow, Russia . 17 June 2013 . ... International conference in honour of Victor Buchstaber on the occasion of his 70th birthday . ... 1-5 July 2013 . 1 March 2013 . Interenational Conference on Algebraic Geometric Topology . ... International conference in celebration of 65th birthday of Yuli Rudyak . ... International Conference . ...

Еще в разделе: (Показать все результаты (>136) - higeom.math.msu.su/ )

• Old conferences (English)