... Manuscripts are classified in size into the three categories: . ... The most stringent requirements are imposed on manuscripts of the first category. ... Manuscripts of the second category should contain a representation of main results without excessive details in conclusions and proofs. ... Manuscripts should be prepared in electronic form using LaTeX 2.09 (see the instructions for manuscript preparation in electronic form) . ... The manuscript should be signed by its author(s). ...

Еще в разделе: (Показать все результаты (>22) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник

... a 1-day conference dedicated to the 70th Anniversary of S.P.Novikov . ... 3 June 2008 . Conference on Algebraic and Geometric Topology . ... International Conference . ... New Horizons in Toric Topology . ... 7-12 July 2008 . ... Third Arolla Conference on Algebraic Topology . ... 14-18 August 2008 . ... New! ... Algebraic Topology Conference . ... Topology ATLAS: Conferences and Seminars . British Topology conference list (maintained by Sarah Whitehouse) . Don Davis's conference list . ...

Еще в разделе: (Показать все результаты (>106) - higeom.math.msu.su/ )

• Old conferences (English)

... Initiation of Destructive Strike Acoustic Wave in the Liquid of the Big Volume at the Temperature Near to Boiling Point . ... Let, in the closed reservoir not completely filled by liquid at the temperature near to boiling point, the pressure decreases quickly. Here, the temperature of liquid boiling decreases also quickly and if it is less than original liquid temperature, the part of the internal energy will be expended for vapor formation. ...

Еще в разделе: (Показать все результаты (>57) - acs366.phys.msu.su/ )

• ISNA-16

Sergey Vladimirovich Petrushanko Afflilation and official address: Skobeltsyn Institute of Nuclear Physics , Lomonosov Moscow State University Leninskiye Gory, Moscow 119991, Russia E-mail: sergeant@mail.cern.ch Date and place of Birth: 24 March 1975, Sverdlovsk (USSR) Citizenship: Russian Federation Education: 2002 Ph.D. (High energy physics ) Skobeltsyn Institute of Nuclear Physics , Lomonosov Moscow ...

Еще в разделе: (Показать все результаты (>31) - lav01.sinp.msu.ru/ )

• http://lav01.sinp.msu.ru/rdmscms/bul2.html
• Title and CV of Igor Lokhtin
• Title and CV of Olga Kodolova

... It can be applied to the studies of not only crystalline solids, but also to studies of various disordered, nanocrystalline, amorphous and liquid systems. In our laboratory we use EXAFS to study the local environment of isovalent and nonisovalent impurities in narrow-gap IV-VI semiconductors with a particular emphasis to off-center impurities which can induce the ferroelectric phase transition in these crystals. ... A.I. Lebedev, I.A. Sluchinskaya, V.N. Demin and I.H. Munro. ...

Еще в разделе: (Показать все результаты (>30) - scon155.phys.msu.su/ )

• Low-temperature phase transitions in some quaternary solid solutions of IV-VI

... About CIE MSU . ... Student's Life . ... Vestnik CIE (in Russian) . ... About Moscow University . ... Life . ... Students life in personal extracts presented to us by one of our students. A Normal Day, 30 Nov 2004, 11.20pm (Moscow time) . ... Since school always begins at 10am, my alarm-clock starts its attempts to wake me at 08.40am. ... But to get in time to the university I cannot sleep more then these ten extra minutes. ... As usual, I try to make all morning routines as regular as possible. ...

Еще в разделе: (Показать все результаты (>65) - www.cie.ru/ )

• Cultural Programmes and Excursions :: Academic Programmes :: CIE
• Apply Online
• Russian Language Programmes :: Academic Programmes :: CIE

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>108) - www.genebee.msu.ru/ )

• Fasta3 help
• Picornaviruses: discovering big in small
• MUSCLE 3.6

The existence of oceanic islands and seamounts is supposed to be the one of the main evidence of the plate tectonic theory. But there is no such acient geological object which could be so similar to rock complex of oceanic island. These structures must include the alkaline magmatism manifestation, sedimentary rocks close to recent riff limestone on the oceanic islands and sequence of terrigenic rocks. ... 100.00 . ... H 2 O calculated by the 100% norm of cations. d.l.. ...

Еще в разделе: (Показать все результаты (>650) - geo.web.ru/ )

• Представление специалиста

... About the park-museum "Kolomenskoye" Kolomenskoye is a nice park and a former royal estate situated several kilometers to the southeast of the city center of Moscow, on the ancient road leading to the ancient picturesque town of Kolomna (hence the name). ... The estate was one of the favourite places for Ivan the Terrible. ... In XVI-XVII centuries there develops a unique architectural ensemble, subordinated to the idea of ceremonial royal residence, which is of great artistic and historical value. ...

Еще в разделе: (Показать все результаты (>2) - math.phys.msu.ru/ )

... Write {{ note text }} anywhere in a topic. ... FOOTNOTE{LIST="Web.Topic"}% will be replaced by the notes from an %INCLUDE% ed page. ... Tim Berners-Lee{{Tim Berners-Lee is now director of the World Wide Web Consortium, and Professor of Computer Science at Southampton ECS.}} invented the World Wide Web. ... Tim Berners-Lee (1) invented the World Wide Web. ... Notes 1 : Tim Berners-Lee is now director of the World Wide Web Consortium, and Professor of Computer Science at Southampton ECS. ...

Еще в разделе: (Показать все результаты (>1903) - wiki.cs.msu.ru/ )

• (backlinks in System Web) VarSTARTSECTION < System < Foswiki
• (backlinks in all Webs) VarSTARTSECTION < System < Foswiki
• (more) VarVARCACHE < System < Foswiki

... The students of the Faculty of Geography study territorial distribution and spatial development patterns of various natural phenomena as well as social and economic objects. ... The academic program includes courses with lectures, seminars, laboratory and field training in natural sciences and humanities which form 4 blocks: . ... In addition to the field stations of the Faculty, the students have an opportunity to have their field training in scientific institutions and different companies. ...

Еще в разделе: (Показать все результаты (>5) - www.eng.geogr.msu.ru/ )

• Postgraduate study

Alexander Dmitrievich Ryabov . ... Place of Birth: Moscow, Russia (USSR) . Higher Education - Department of Chemistry, Moscow State University, Russia . ... 1976 - Graduated the Department of Chemistry, Moscow State University . ... Professor of Chemistry, Division of Chemistry, G. V. Plekhanov Russian Economic Academy, Moscow, Russia; February 1989 -; Professor of Chemistry, Division of Chemical Enzymology, Department of Chemistry, Moscow State University; Moscow, Russia; September 1993 - . ...

Еще в разделе: (Показать все результаты (>87) - www.enzyme.chem.msu.ru/ )

• Raeva A.A.
• Azizov R.E.
• Stepanov N.A.

... PhD student, Physics Department, M.V.Lomonosov Moscow State University . ... International Laser Center and Faculty of Physics . M.V.Lomonosov Moscow State University . Moscow 119899 . ... 2016 Quantum Information Laboratory. ...

Еще в разделе: (Показать все результаты (>52) - qilab.phys.msu.ru/ )

. Previous Next Galleries . Sometimes our group meeting takes place outside the University :-) . Previous Next Galleries

Еще в разделе: (Показать все результаты (>11) - www.inorg.chem.msu.ru/ )