Lectures on Nanomagnetism Prof. M. Farle www.unidue.de/agfarle University DuisburgEssen ( Lectures will be given in English with (partial) Russian translation upon request) th Lecture Hall: library of faculty of physics, 5 floor Monday, 24.03.2014 Duration 30 min 15:15 15:45 30 min 15:45 16:15 30 min 16:15 16:45 break 45 min 17:00 ґ 17:45 45 min 17:45 ґ 18:30 Tuesday, 25.03.2014 45 min 15:15 ґ 16:00 45 min 16:00 ґ 16:45 break 45 ...

Еще в разделе: (Показать все результаты (>174) - phys.msu.ru/ )

• http://phys.msu.su/upload/iblock/941/gp2012appform.doc
• http://phys.msu.su/upload/iblock/ac4/firstcircular.pdf

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>90) - npidb.belozersky.msu.ru/ )

... Conformational Analysis of Boron-Containing Compounds Using Gillespie-Kepert Version of Molecular Mechanics . ... Abstract - Molecular mechanics force field for boron-containing compounds based on CHARMM parameters and Gillespie-Kepert (GK) model is developed. ... The force field provides an accurate description of experimental X-ray stereochemistries in a wide range of organoboranes, organoborate complexes with polyhydroxy compounds, mixed oligomers of boric acid and borates. ...

Еще в разделе: (Показать все результаты (>33) - analyt.chem.msu.ru/ )

• Study of amino- and pyridyl-containing zinc(II) and cadmium(II) complexes by

THE JOURNAL OF CHEMICAL PHYSICS 136, 034902 ( 2012 ) Electrostatic interaction of neutral semi-permeable membranes Olga I. Vinogradova,1,2 , and Vladimir Lobaskin6 1 a) Lyderic Bocquet,3 Ar tem N. Bogdanov,1 Roumen Tsekov,4,5 A. N. Frumkin Institute ... This gives rise to a distance-dependent membrane potential, which translates into a repulsive electrostatic disjoining pressure. ... Phys. 136, 034902 (2012) interacting semi-permeable membranes. ... The membranes are located at |x| = h/2. ...

Еще в разделе: (Показать все результаты (>35) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/paper/JCP2014-2.pdf
• http://nanofluidics.phys.msu.ru/paper/jcp20042.pdf
• http://nanofluidics.phys.msu.ru/paper/jpcm2011.pdf

... ICONO Invited Speakers . ... Gennadiy Kulipanov, Budker Inst. of Nuclear Physics, Russia . ... Marlan Scully, Texas A&M Univ., ... Andrey Goncharov, Inst. of Laser Physics, Russia . ... Vladimir Trunov, Inst. of Laser Physics, Russia . ... Since 1987, he has worked at the National Research Council of Canada (Ottawa) in the field of laser physics and trapped ion optical frequency standards. ... Alexey Taichenachev , Inst. of Laser Physics, Russia . ... S. Vatnik, Inst. of Laser Physics, Russia . ...

Еще в разделе: (Показать все результаты (>8) - iconolat13.phys.msu.ru/ )

• Guidelines

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... Surface disturbance and deformat ion are shown in the same scale. Displac the free surface is much smoother as compared bottom deformations: init ial elevat ion has amplitude and spreads over a rather wide area. bottom theory, bottom ement of with the smaller F ґ velocity potential, H ґ depth, ґ vector of bottom deformation, 0 ґ initial elevation a . ... The init ial elevation assumed to be equal to the vertical bottom deformat ion (a); calculated with use of the Laplace smoothing algorithm (b). ...

Еще в разделе: (Показать все результаты (>15) - ocean.phys.msu.ru/ )

• http://ocean.phys.msu.ru/courses/geo/lectures-addons/02/2006%20Wood%20et%20al.%2C%20Accretion%20of%20the%20Earth%20and%20segregation%20of%20its%20core.pdf
• http://ocean.phys.msu.ru/courses/stathyd/2002%20Smyth%20et%20al.%2C%20Shear%20instability%20and%20gravity%20wave%20saturation%20in%20an%20asymmetrically%20stratified%20jet.pdf

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . Alt >> Hard .Linux >> Re: Новинки программного обеспечения . ... Re: Новинки программного обеспечения [ re: bmv ] . ... It was present in older version and has now be . ...

Еще в разделе: (Показать все результаты (>2451) - www.snto-msu.net/ )

• как в матлабе записать квадратную матрицу в файл тхт? - Public forum of MSU
• [News] Научное программное обеспечение - Public forum of MSU united student
• Проблемы с MSDN, что c VS2005 Feb CTP - Public forum of MSU united student

... Real environments where objects are settled down are non-uniform and they are the source of many physical problems of acoustical imaging. ... Two groups of methods of image reconstruction in non-uniform environments are considered, and the basic attention is given to nonlinear phase methods as unlike methods of the first group, wave front inversion by matched filtering processing, they do not require detailed knowledge of parameters of the non-uniform medium. ... Acoustics of non-uniform mediums. ...

Еще в разделе: (Показать все результаты (>92) - www.msm.biophys.msu.ru/ )

. Name . Last modified . Size . Description . about_center/ . 14-Sep-2013 14:31 . - . sections/ . 31-Oct-2007 14:46 . - . Apache/2.2.16 (Debian) Server at educenter.sinp.msu.ru Port 80

Еще в разделе: (Показать все результаты (>9) - educenter.sinp.msu.ru/ )

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>19) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/seminar/Gracheva.pdf
• http://antares.sinp.msu.ru/docs/Gracheva_Bamberg_22.09.11.pdf

... A 163 Hue and saturation shifts from spatially induced blackness David L. Bimler,1,* Galina V. Paramei,2 and Chingis A. Izmailov3 Department of Health and Human Development, Massey University, ID 97849); published December 24, 2008 We studied changes in the color appearance of a chromatic stimulus as it underwent simultaneous contrast with a more luminous surround. ... Lie [14] distinguished between the "brightness" and "whiteness" of achromatic color in surface mode. ... A 167 Fig. ... Fig. ...

Еще в разделе: (Показать все результаты (>158) - www.psy.msu.ru/ )

• http://www.psy.msu.ru/science/psyrussia/2009/suprun.pdf
• http://www.psy.msu.ru/science/psyrussia/2012/isaychev.pdf
• http://www.psy.msu.ru/science/psyrussia/2009/nikolaeva.pdf

Setting Up a Pay System Canada Business Service Centres - CBSCs Last Verified: 2004-05-28 Document No. 4046 Summary Pay administration is a management tool that enables you to control personnel cost, increase employee morale, and reduce work force turnover. ... This publication provides time-tested concepts for determining competitive pay levels and for maintaining fair pay relationships among the jobs comprising a small company. ... appraise employee performance under the plan. ... job title; . ...

Еще в разделе: (Показать все результаты (>19) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/english/reportofinvention.doc
• Start-Up Company Development :: Управление инновационной политики и организации

... inverse problems for mathematical physics equations and their applications in geophysics, electrodynamics, optics, medicine; . ... Differential equations by Prof. Denisov, Prof. Dmitriev, Prof. Razgulin, 64 lecture hours and 64 seminar hours, 3rd and 4th semesters. ... Equations of mathematical physics by Prof. Denisov and Prof. Zakharov, 32 lecture hours and 32 seminar hours, 5th semester. ... Inverse problems of mathematical physics by Prof. Dmitriev, 32 lecture hours, 8th semester. ... CMC MSU т?...

Еще в разделе: (Показать все результаты (>170) - en.cs.msu.ru/ )

• Laboratory of Industrial Mathematics | CMC MSU
• Laboratory of Industrial Mathematics
• Research Laboratory of Computational Modeling Tools | CMC MSU

Ultraviolet data (DUV) . ... The section "Original data" contains original information in analogue-digital and digital- analogue codes. The section "Data for analysis" contains pre-processed data for further analysis. Tatiana" program can be used for graph presentation of the experimental data, and "Orbitron" program - for geographical control of the data. Manual on how to use the programs and the data is in the HELP-file. ... Original data . Data for analysis . Tatiana program . ...

Еще в разделе: (Показать все результаты (>51) - cosmos.msu.ru/ )

• University Satellites and Space Science Education '2006

About SPAW Editor . ... As of final version 1.0 of the control you'll need to rename the file spaw_control.default.config.php in config sub-directory to spaw_control.config.php when installing control for the first time. ... All of the SPAW Editor configuration options are located in the config/spaw_control.config.php file. ... This file will be included in img_library.php (Image library dialog script). $request_uri variable will be set to the URL of the page where SPAW Editor instance resides. ...

Еще в разделе: (Показать все результаты (>81) - textbook.sinp.msu.ru/ )

• Index of /modules/ax_content/atomax/spaw/lib/themes/default/img
• Index of /modules/ax_content/atomax/spaw/lib/themes/classic/img
• Index of /img

Chair of General Physics and Wave Processes, Physics Faculty of MSU . ... Main Science and education Scientific Laboratories Laboratory of nonlinear polarization optics . ... The mechanisms of evolution of polarization during radiation propagation in nonlinear media with nonlocality of optical response. ... As a result, a new field of science has originated, the nonlinear polarization optics, providing new insights into the interplay of polarization effects in classic nonlinear optical processes. ...

Еще в разделе: (Показать все результаты (>141) - ofvp.phys.msu.ru/ )

• Laboratory of solid-state lasers and coherent spectroscopy
• Laboratory of computer simulations in optics

О лаборатории . ... Лаборатория теоретической биофизики . ... On this page we collect references to our resources, documentation and resources on other sites. All these data are very helpful for everybody who wants to learn practical quantum chemistry. Firefly (PC GAMESS) main page . ... ERG group wrote some articles about visualization: . ... Нет комментариев " Quantum chemistry information page " . ... Quantum chemistry information page . ... 2015 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>41) - erg.biophys.msu.ru/ )

• All-atom automatic OPLS-AA topology generator ERG Research Group: Лаборатория
• Visualize partial charges in PyMol ERG Research Group: Лаборатория
• Gaussian Cube files loader ERG Research Group: Лаборатория теоретической

... Air temperature in the forechamber: 285-295K . ... Aerodynamic unit AR-2 is used for experimental research of heat and mass exchange processes in a model boundary layer, flown over by supersonic air stream. The main part of the unit is supersonic aerodynamic tube of continuous action with regulated plate nozzle, rectangular cross-section of the working part 100x70 and with regulated exit cone. ... Unit AR-2 is a supersonic aerodynamic tube with a regulated supersonic nozzle and an exit cone. ...

Еще в разделе: (Показать все результаты (>8) - termogaz.imec.msu.ru/ )

... -department of Environmental Technology, Wageningen University, PO Box 8129, 6700 EV Wageningen, The Netherlands Keywords Mathematical model ф Upflow anaerobic sludge bed reactor ф Dispersion ф Plug flow ф Sedimentation Nomenclature Coefficients in empirical equations A AC Ash content of the dry sludge aggregates (%) b Bacterial (death+lysis) rate coefficient ( dayю1 ) COD Chemical oxygen demand (g) CS ... Narnoli SK, Mehrotra I (1997) Sludge blanket of UASB reactor: mathematical...

Еще в разделе: (Показать все результаты (>141) - www.enzyme.chem.msu.ru/ )

• http://www.enzyme.chem.msu.ru/~tishkov/Publications/JBiotechnol_97_58_187.pdf
• http://www.enzyme.chem.msu.ru/ekbio/article/WST48(4)27-44.pdf
• http://www.enzyme.chem.msu.ru/ekbio/article/biod98-9.pdf