Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>16) - npidb.belozersky.msu.ru/ )

T he main building of Moscow State at the Vorob?evy Gory university campus (Stalin-like skyscraper) hosts a number of faculties, namely, Faculty of Mathematics and Mechanics, Faculty of Geography, Faculty of Geology, and Museum of Earth. ... Faculty of Physics . ... Humanitarian Building (Philological Faculty, Faculty of Philosophy, Faculty of History, Faculty of State Government, Library for the Faculties of Humanities) . ... D.V. Skobel?tsyn Research Institute of Nuclear Physics (SINP) . ...

Еще в разделе: (Показать все результаты (>44) - foroff.phys.msu.ru/ )

• InformaciСn Importante

... Surface plasmon-polaritons (SPPs) is a collective oscillation of light and electrons that propagate at the boundary between metal and dielectric. ... Ultrafast Laser Pulse Shaping by Plasmonic Crystals . In our group, controllable reshaping of a femtosecond laser pulse reflected from a plasmonic crystal based on 1D polymer grating with period of 750 nm covered by 50 nm silver film. ... Pulse duration ? ... nonlinear crystal. ... Ultrafast Polarization Pulse Shaping with Plasmonic Crystals . ...

Еще в разделе: (Показать все результаты (>99) - nanolab.phys.msu.ru/ )

• Optical tweezers and photonic force microscopy | Laboratory of Nanophotonics &

... Dmitry Stepanovich (VIDEO of March 2011) . Olga Silchenko, a soloist of the Early Music Theatre . ... Anna and Olga Silchenko have presented the duets by Rubinstein and Chaikovsky (VIDEO) . ... Two Russian romances - duets by Olga Silchenko and Dmitry Stepanovich (VIDEO) . ... N. Rimsky-Korsakov "The Tsar's Bride", the duet of Lubasha and Gryaznoy - by Olga Silchenko and Dmitry Stepanovich (VIDEO) . ... Vivaldi "Magnificat", 6th part, duet by Anna and Olga Silchenko (VIDEO) . ... Olga Silchenko . ...

Еще в разделе: (Показать все результаты (>47) - sn.sai.msu.ru/ )

... Published: 24 October 2013 . ... A Science Festival took place in Moscow in October 11-13. ... Among a variety of projects one could find already known robots and absolutely new ones. ... At the same time, not so far away, LIDAR was scanning the surrounding objects and was building a base map. ... While the robots were recharging, we did our best entertaining the audience with the liquid nitrogen showing all sorts of tricks and destroying myths of the film ?Terminator?. ...

Еще в разделе: (Показать все результаты (>84) - engineering.phys.msu.ru/ )

• Participation in IX Science Festival
• X Congress of Russian Rectors Union
• How can I get there

... Полная версия этой страницы: Работа в Samsung . Студенческий форум Физфака МГУ > Общий > Работа . ... Advance CAE lab., ... Building up RF/EMC/ESD CAE solution for mobile handsets . Building up Thermal analysis CAE solution for mobile handsets . ... Mobile terminal RF/EMI/ESD analysis . EMI/ESD simulation and analysis using electromagnetic and circuit simulation CAE tools . ... Mobile terminal Thermal analysis . ... Familiar to mobile handset or other thermal analysis experiences . ...

Еще в разделе: (Показать все результаты (>971) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > With love from NY
• Студенческий форум Физфака МГУ > Менеджер-проектировщик
• Студенческий форум Физфака МГУ > Каррент мьюзик

яЛП . id #416 . Structural Design of Tall Buildings [not defined] . Common information . Periodicy: . [no information] . Impact-Factor: . [no information] . ISSN: . 1099-1794 . In print: . since 1997-01-01 till 2002-12-31 . Language: . en . Price: . single article - $1 . Classifier: . [no at all] . Comment: . From 2003: The Structural Design of Tall and Special Buildings . Published by . (4) . Wiley Interscience - roboUpdate . No homepage defined . No open resources defined . Close . Complain . Edit

Еще в разделе: (Показать все результаты (>51) - journals.genebee.msu.ru/ )

... Photogallery: Tura, Evenkia, July-August 2007 . Tura . ... Tura roofs seen from the building of the district government . ... The Tunguska . The river Nizhniaya Tunguska seen from the building of the district government . ... Waiting for the flying weather in Tura airport . ... We are waiting for flying weather at the bank of the Nizhniaya Tunguska . We are waiting for the flying weather inside Tura airport . We are waiting for the flying weather outside Tura airport . ...

Еще в разделе: (Показать все результаты (>16) - lcl.srcc.msu.ru/ )

... Next: SPM Set-up Up: Introduction Previous: Introduction Contents Index . FemtoScan `` Software is intended to control Scanning Probe Microscope (SPM) and to process images acquired by SPM. The results of experiments depend much upon user's knowledge and understanding of scanning probe microscope operation principles, as well as data analysis and representation principles. ... SPM Set-up . ... Next: SPM Set-up Up: Introduction Previous: Introduction Contents Index Filonov 2005-02-04 ...

Еще в разделе: (Показать все результаты (>101) - www.spm.genebee.msu.ru/ )

• Fast probe landing and retraction
• Image formation and processing methods
• COM-port initialization file format

... The Department of Operations Research . April 9, 2016 . Welcome Traditional topics of the conference Important dates Abstracts Registration . Final program Accommodation Program committee Organizing committee . ... V Moscow International Conference . on Operations Research, . ... Moscow, April 10-14, 2007 Important dates . ... Abstract deadline: December 20, 2006 . New deadline: January 10, 2007 . Notification of submission: February 1, 2007 . Create Date : 23.05.05 . ...

Еще в разделе: (Показать все результаты (>11) - io.cs.msu.ru/ )

Title Author Key words International political symbolism of the architecture of government buildings V.V. Kochetkov sociology of architecture, the architecture of government buildings, crosscultural differences, political culture The article analyzes international political architecture of government buildings in Russia, the U.S., Western Europe (UK, France, Germany) and Asia (China, India, Japan). ... Such, for instance, the U.S. Capitol and Capitol Temple Rome. Abstract ...

Еще в разделе: (Показать все результаты (>58) - www.socio.msu.ru/ )

• http://www.socio.msu.ru/documents/umo/bologne/Sorbonne%20Joint%20Declaration.%20Joint%20declaration%20on%20harmonisati.pdf
• Вестник МГУ
• English version - Социологический факультет МГУ

... MSU Chamber Orchestra . ... 6.30 p.m. M.V. Lomonosov Moscow State University . ... at the 31 st floor of the Main building . The Music Evenings at the 31 st floor" . ... Alexander Konstantinov, music director . ... Nilufar GOIBOVA ( soprano ) . ... Moscow State University . The Main building at Vorob'evy Gory ('University' metro station) . ... Culture Centre of Moscow State University . ... ADDRESS: Main building of Moscow State University at Vorobjovy Gory (metro station "Universitet") . ...

Еще в разделе: (Показать все результаты (>23) - music.genebee.msu.ru/ )

... site navigation | footer (site information) . IChO-2007 Participation Problems IChO RUSSIA Sponsors search . ... Moscow-1996 | ... Chemistry Department | ... Homepages of National Competitions Other International Science Olympiads Previous IChO's Miscellaneous Chemistry sites . ... Some fresh information is available. A letter from the President of 39th IChO . ... Information about post-Olympiad tour is now available . ... Information about guides of 39th IChO is now available. ...

Еще в разделе: (Показать все результаты (>2) - icho39.chem.msu.ru/ )

Psychology in Russia: State of the Art Volume 6, Issue 2, 2013 Russian Psychological Society Lomonosov Moscow State University B O OK REVIEW Review of the book by Vyacheslav a. ivannikov "a new introduction to Psychological Thinking" Eugene Aidman, University of Sydney, Australia First, a disclaimer: the book I am about to review is written by my mentor. ... V.A. Ivannikov's "Bases of Psychology : A Lecture Course" (Moscow : Peter Publishing, 2010, 327pp.) is an unusual book. ... New York: Wiley. ...

Еще в разделе: (Показать все результаты (>166) - www.psy.msu.ru/ )

• http://www.psy.msu.ru/science/psyrussia/2013-3/2013_3_4-18.pdf
• http://www.psy.msu.ru/science/psyrussia/2013-2/bazarov_2013_2.pdf
• http://www.psy.msu.ru/science/psyrussia/2013-3/2013_3_150-163.pdf

... Презентация по машинному переводу от Google на коллоквиуме по базам данных в МГУ . 2-го июня в 11:00 во 2-м учебном корпусе МГУ (здание факультета ВМиК МГУ) состоится презентация исследователя из Нью-Йоркского отделения Google на тему: "Building a Large-Scale Machine Translation System" ("Построение масштабируемой системы машинного перевода"). ... Презентация проводится на английском языке; аннотация презентации и информация о докладчике представлена ниже: . ... 2003 2011 MsuNews.Ru Новости МГУ . ...

Еще в разделе: (Показать все результаты (>40) - www.msunews.ru/ )

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>136) - bioinf.fbb.msu.ru/ )

• SDPsite - PF07978
• SDPsite - PF01171
• SDPsite - PF01205

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

Registration completed on this website places you onto the symposium participants list. ... You must confirm your participation in the symposium at the registration desk located in the lobby of "Small Biological Auditorium MI" (Malaya Biologicheskaya) on the second floor of the south wing of the Biological Faculty building. ... Please clearly display your badge while you are inside of the building. ... If you plan to attend, please fill out respective line in the registration form. ...

Еще в разделе: (Показать все результаты (>199) - www.genebee.msu.ru/ )

• Biochemistry (Moscow), Vol
• Основной заголовок
• AliComp - GeneBee Alignment Comparison Help

... Many presentations concern interesting work, but are nevertheless difficult to follow because the speaker unknowingly makes a number of presentation errors. ... Time 1 Conclusion Audience Attention Introduction Various Themes Efficient Presentation Intermediate Conclusion Intermediate Conclusion Average Presentation Figure 2 Ideal attention curve of an audience when the speaker divides his talk in recognizable parts, each summarized by intermediate conclusions. ... What is a successful poster? ...

Еще в разделе: (Показать все результаты (>19) - www.kge.msu.ru/ )

• Публикации

Gus Koehler . Useful Hints for Reordering the Universe . Gus Koehler, Time Structures . Alfonso the Wise, King of Castile (1221-1284) said: ?Had I been present at the Creation, I would have given some useful hints for the better ordering of the universe.? What would King Alfonso the Wise have to know about space/time ordering to make useful hints to God? ... Can the King use time to order space? ... What useful hints can the King of Castile provide to God? ... Time, Order and Chaos . ...

Еще в разделе: (Показать все результаты (>464) - chronos.msu.ru/ )

• M. H. Shulman
• THE PROBLEMS IN EXPERIMENTAL FOUNDATION OF CAUSAL MECHANICS
• Rosolino Buccheri. Time and the dichotomy subjective/objective. An