Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>9) - npidb.belozersky.msu.ru/ )

• NPIDB: 5DPK structure

... The laboratory of Quantum Information and Quantum Optics (QIQO) was organized in the summer of 2006 on the basis of Spontaneous Parametric Down-Conversion laboratory. It was designated to work on specific topics in the new field of quantum information and quantum communication. ... Possible applications - development of quantitative methods to analyze the degree of entanglement of two-photon states, as well as engineering of specific states for quantum information and communication purposes. ...

Еще в разделе: (Показать все результаты (>83) - qi.phys.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf

. Feel free to write me: plusn@mars.biophys.msu.ru . Or call : tel +7-095-939 1963(work) . [Curriculum Vitae] ["Math. modeling" Group] . [Research Description] . Back to Math.Modeling Group Homepage .

Еще в разделе: (Показать все результаты (>6) - biophys.msu.ru/ )

• Galina Riznichenko Homepage

Sexual love", .. , «» . ... If it takes forever, I will wait for you.. ... What is love? ... k) s0L ( r) = 1 as ( ) d 3 xg (k ) ( x, r ) (k ) L ( x) - { ^ L0 - d 3rg (k ) ( x, r ) 0 ( r ) + (k) s0L ( r ) (n) } (k) L ( x ) = k (k) L ( x) = {Q ( t ) + n d 3r (n) ( r ; ) ( r )} / ( ) , ? ... VI. : 0,4 0,3 s, relative units - 0,2 0,1 0,0 0 1 2 3 s 4 5 dimensionless time, t/ Fig.3 1,1 1,0 0,9 0,8 s, relative units 0,7 0,6 0,5 0,4 0,3 0,2 0,1 0,0 -0,1 0 5 10 15 s - 1 20 dimensionless time, t/ Fig.4 , . ...

Еще в разделе: (Показать все результаты (>91) - electr003.chem.msu.ru/ )

• Academician Aleksandr Naumovich Frumkin

The course is called Russian Civilizations Through American Eyes The course is a study of Russian history as it written and taught in the United States. The students discuss the different perceptions of Russian history from their knowledge and western interpretation of the same events or time frame. ... The classes meet for Second Year on Tuesday, 14:30-16:00 (Room 219) and 16:20-17:50 (Room 120). The Fourth year students meet Thursday, 16:20- 17:50 (Room 120). ...

Еще в разделе: (Показать все результаты (>12) - suny.msu.ru/ )

SUPERVISOR program User Guide SV version 0.24 Kornilov V., Shatsky N., Voziakova O. March 22, 2004 1 Contents 1 Basic principles 2 Comp onent programs 3 Writing the scenaria 4 Editing the SV configuration file 5 Starting the system A Command list for the communication of the system Sup ervisor A.1 Commands acknowledgment . ... Initialization should b e done b efore scenario starts execution of measurements ­ i.e. b efore sending any commands implying the non-parked status of comp onents. ...

Еще в разделе: (Показать все результаты (>21) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/infrasoft_eng.pdf
• http://curl.sai.msu.ru/mass/download/doc/res2007eng.pdf
• http://curl.sai.msu.ru/mass/download/doc/rcx_advices.pdf

... Mathematical Theory of Feedback Control . ... Annotation: this course is about mathematical equations of atmospheric diffusion which allow modeling of the problems of environment. ... The course reflects the experience and the point of view of a research group in the field of mathematical modeling of Western, Soviet and later Russian economics. ... Such approach captures the behavior of rather complex systems. ... Scientific Seminar: Mathematical Modeling of Complex Systems . ...

Еще в разделе: (Показать все результаты (>13) - hcs.cmc.msu.ru/ )

• Mathematical models and methods in VLSI design | Магистерское и послевузовское
• Master program "Mathematical Models of Complex Systems" | Магистерское и
• Master program "Information Security and Cryptography" | Магистерское и

... Control of the Self Assembly Processes in a Droplet of a Colloidal Solution by an Acoustic Field O. V. Rudenkoa, P. V. Lebedev Stepanovb, V. A. Guseva, A. I. Korobova, B. A. Korshaka, N. I. Odinaa, M. Yu. ... The self assembly in the course of solvent evapora tion occurs owing to capillary forces, which displace the particles in the near surface layers of the solution as the volume of the latter decreases. ... For simplicity, we replace the actual droplet on a solid substrate by a plane liquid layer...

Еще в разделе: (Показать все результаты (>45) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/trubochki.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/perehody.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/dd10proc.pdf

... In recent years enormous growth of interest in the polarization reversal in ferroelectric thin films is caused by exiting results in producing of integrated ferroelectric devices, first, nonvolatile dynamic memories. In present paper we will review the main experimental results concerning domains' evolution during switching and the theoretical description of this phenomenon taking into account the peculiarities of the process in thin films. ...

Еще в разделе: (Показать все результаты (>106) - scon155.phys.msu.su/ )

• Time evolution of an incommensurate structure of Rb2ZnCl4 in uniaxial
• EXAFS studies of the local structure of In in PbTe, SnTe and GeTe
• First-principles calculations of physical properties of crystals

... Electronic journal Issue 4. 10 september 2004 Leigh E. Making Learning a Game Introduction. As a university lecturer I enjoy playing games with learning goals in mind. My students are all adults who work in many different roles. ... Their needs include learning how to design activities that will support acquisition of practical skills, extend personal understanding of emotional factors, and improve awareness of factors ­ such as economic, ecological and political aspects of society. ... Play. ...

Еще в разделе: (Показать все результаты (>9) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./briedis.pdf