... Кафедра системного анализа ВМК МГУ . ... О кафедре . ... на кафедру . ... ВМК . МГУ . ... СМУ ВМК . ... Alexandr Borisovich Kurzhanski) . In Russian . ... Kurzhanski was Elected Associate Member of USSR Academy of Sciences (now changed to Russian Academy of Sciences) in 1981 and Full Member in 1990. He is the Chairman of the Russian National Committee on Automatic Control (the IFAC NMO). ... Chairman of Russian National Committee of Automatic Control. ... 4 (8). pp. 100-118. (in russian). ...

Еще в разделе: (Показать все результаты (>3) - sa.cs.msu.ru/ )

... Ты приезжай на Новый Год . Пока мне 39 лет.. ... Пройдет каких-то лет пятнадцать.. ... Снегопад, снегопад, снегопад.. ... Когда-то восемь лет назад.. ... Новым чувством не играют.. ... Новый год . Год тигра . ... Год Тигра (песня) . ... Фрагмент 1 . ...

Еще в разделе: (Показать все результаты (>90) - polly.phys.msu.ru/ )

• Selected publications of Chertovich, Alexander Viktorovich
• Alexander V. Emelyanenko's Homepage
• Alexander's Malafeev homepage

... Alexei Lidov.. ... The creation of sacred space as a form of creativity and subject of cultural history .. ... 91 Mikhail V. Bibikov Byzantine Eden: "time in space" .. ... 140 Svetlana Popovi The Byzantine Monastery: its Spatial Iconography and the Question of Sacredness .. ... 525 762 Milena Rozhdestvenskaya The Creation of Sacred Space in Medieval Russian Literature: apocrypha and chronicles .. ... 556 Vladimir V. Sedov The Sacred Space of the Medieval Russian Church: the Architectural Aspect .. ...

Еще в разделе: (Показать все результаты (>9) - imk.msu.ru/ )

... Opening of the educational programme - School of CEOs, "Capsule of security" for the key managers of Bashneft Group. ... April 11, 2013 - Bashneft Group in conjunction with JSFC "Sistema" opened the programme for the development of key Bashneft Group management - School of CEOs, "Capsule of security". ... At the end of his Welcoming Speech President of Bashneft Group stressed that this programme ? ... The School of CEOs ? ... 2006-2016 MSU Higher School of Management and Innovation. ...

Еще в разделе: (Показать все результаты (>5) - hsmi.msu.ru/ )

Foswiki is a development of the Foswiki community. Foswiki is based on TWiki^®, which was originally written by Peter Thoeny, who based his work on Jos Wiki and parts of Ward Cunningham's original Wiki. ... TWiki is a registered trademark of Peter Thoeny. ... Foswiki:Main.ArthurClemens | Netherlands | ... Germany | ... http://andrew-jones.com | ... Brazil | ... USA | ... Canada | ... Australia | ... As stated, Foswiki is based on TWiki. ... http://www.structuredwikis.com/peter | ...

Еще в разделе: (Показать все результаты (>1061) - wiki.cmc.msu.ru/ )

• ProjectContributor < System < Foswiki

MOSCOW STATE UNIVERSITY -- Faculty of Biology -- Department of Human Physiology -- . ... Our interest is the secret springs of work of a brain. How can a new idea be born in the brain if the physical environment remains constant? ... What mechanisms of the brain are broken in schizophrenia? ... For this purpose we create brain-computer interfaces (BCI) based on modern methods of computational electroencephalography. ... Department of Human Physiology . ... Former Visitors . ... Former students . ...

Еще в разделе: (Показать все результаты (>36) - brain.bio.msu.ru/ )

• Alexander Kaplan * Александр Каплан
• Nonparametric approaches to the description of EEG piecewise stationary
• Alexander Zhigalov

... Probleme desZwciten Weltkrieges, Koln, Berlin 1967, S. 197, прим.34. ... См. прим.1. ... Woodward (прим. ... Their co-peration and conflict 1941-1946, Survey of International Affairs 1939-1946, London 1953, p. 270: "Безоговорочная капитуляция является хорошим лозунгом войны для лагеря союзников и удобным предлогом отложить решение трудных проблем послевоенной политики и отношений держав". ... 36), Vol. 7, p. 462 f.:" Они (немцы) предпочтут тотальный тeppop "безоговорочной капитуляции"". ...

Еще в разделе: (Показать все результаты (>159) - www.pereplet.ru/ )

• Герхард Шрайбер

The Chair of Mathematical Theory of Intelligent Systems and . ... of Moscow State University Official Website . ... Staff . ... Alexander Borisovich Kholodenko was born on November 15, 1976 in Moscow. ... Alexander Kholodenko graduated from the Faculty of Mechanics and Mathematics in 1999 as a student in mathematics and in 2002 as a post-graduate student in mathematics. ... Kholodenko A.B. About the creation of statistic language models for Russian speech recognition systems. Intelligent systems. ...

Еще в разделе: (Показать все результаты (>37) - www.intsys.msu.ru/ )

• Intelligent Systems :: Staff :: Safiullin Alexander Naifovich
• Intelligent Systems :: Staff :: Andreev Alexander Egorovich
• Intelligent Systems :: Staff :: Kudrin Alexander Alexandrovich

. Here you can find friends. _:_ .. Vital and Michael . Andrew A. Martis . Sania Berezin (in Reebok) and Piter Bogdanovskiy image . Sergey Popov : home page. Andrew Lobanov : home page. Andrey Kravtsov : home page. Happy birthday to you , Max ! .

Еще в разделе: (Показать все результаты (>24) - comet.sai.msu.ru/ )

... Identities = 27/91 (29%), Positives = 44/91 (48%) Frame = +2 Query : 9 RFAPSPSGELHFGSLIAALGSYLQARARQGRWLVRIEDIDPPREVPGAAETILRQLEHYG 68 RF P P+G LH G + ++ A QG +R +D +P +E ++I + +E G Sbjct : 3014 RFPPEPNGYLHIGHAKSICLNFGIAEDYQGLCNLRFDDTNPVKEDVEYVDSIKQDVEWLG 3193 Query : 69 LHWDGDVLWQSQRHDAYREALAWLHEQGLSY 99 W+G+ + S D L E+GL+Y Sbjct : 3194 FKWEGEPRYASDYFDQLYGYAIELIEKGLAY 3286 Database : pm Posted date: Oct 28, 2009 6:14 PM Number of letters in database : 2,269,587 ...

Еще в разделе: (Показать все результаты (>123) - kodomo.fbb.msu.ru/ )

You are here: Foswiki > System Web > JQueryPlugin > JQueryLoader (24 Oct 2011, ProjectContributor ) E dit A ttach . ... This plugin allows to delay rendering parts of a page that are loaded later on asynchronously and patched into the page. ... Then add the jqLoader css class to the div (or verbatim) element which will serve as a container for the content to be loaded. Any jqLoader container requires either an url or a section parameter to specify the location from where to load the content. ...

Еще в разделе: (Показать все результаты (>83) - wiki.cs.msu.ru/ )

... IUPAB) 28 ­ 2 2007, . IUPAB -. Ian C.P. Smith Ian C.P. Smith () () Henrik Flyvbjerg () () () () () () Joe Tien () () () () Erik Mosekilde () Leonardo Masotti () Michael Andre () () John Connally () ( ) () () Aaron Fenster () () Latchezar Avramov () Sylwester Sommer () Andrzej Wojcik () Stanislav Kozubek () Radostina Georgieva () 800. : ­ 1 2007, ­ 28 2007 http://www.msm.biophys.msu.ru dubna2007@biophys.msu.ru . 939-19-66 ...

Еще в разделе: (Показать все результаты (>6) - www.msm.biophys.msu.ru/ )

• Modern spectroscopy methods

... Following assumptions on decreasing of the spatial scales due to rapid rotation, we propose a subgrid model of eddy diffusivity used in the large­scale model. ... This gives the following estimates of molecular Reynolds and Peclet numbers: Re M = VwdL љ M ё 10 9 and Pe M = VwdL џ M ё 10 8 , where Vwd = 0:2 ffi year \Gamma1 is the west drift velocity and L = 3 \Delta 10 6 m is the liquid core scale [4], which corresponds to the regime of highly developed turbulence. ... The large­scale equations. ...

Еще в разделе: (Показать все результаты (>13) - num-meth.srcc.msu.ru/ )

• http://num-meth.srcc.msu.ru/english/zhurnal/tom_2006/ps/v7r110.ps

... Faculty . ... News . ... 32-bit Microcontroller Programming . Microcontroller Control of Motors . Second-year students classes . ... Parallel Programming . ... Microcontroller Programming . ... Microcontroller-related . ... 2012/2013 . 2011/2012 . ... Serguey Elizarov . ... We sincerely wish you a Happy New Year and Merry Christmas! We hope that this year has been for you a year of new achievements. ... Happy New Year 2016! ... Senior Teacher of the Faculty of Physics at MSU,љ Cand. ...

Еще в разделе: (Показать все результаты (>68) - engineering.phys.msu.ru/ )

• Alexander Iovlev
• Alexander Monahov

Laboratory of Micro- and Nanofluidics . ... Moscow State University . ... Research . ... Ph.D. student, Junior Research Fellow . Type of research: . computer simulations . ... Alexander S. Potapov studied physics and nanotechnology at M.V.Lomonosov Moscow State University. In 2010, he joined our group to work on his Diploma project, in which he has modelled the electro-osmosis of thin wetting films. ... The same year he became a PhD student and was appointed as a junior research fellow. ...

Еще в разделе: (Показать все результаты (>27) - nanofluidics.phys.msu.ru/ )

• Alexander Vadimovich Kochergin
• Laboratory of Micro- and Nanofluidics
• Dubov

... Mikhail Mashkovstsev (Russia) . ... Chairmen: Boris Levin (Russia), Jody Bourgeois (USA) . ... RECENT ENHANCEMENTS TO PTWC LOCAL/REGIONAL TSUNAMI WARNING CAPABILITIES FOR HAWAII . ... DEVELOPING MODELING TOOLS FOR TSUNAMI WARNING AND MITIGATION . ... THE CONCEPT OF LOCAL TSUNAMI WARNING SYSTEM IN THE PROJECT OF RESTORATION AND DEVELOPMENT NATIONAL TWS OF RUSSIA . ... HARDWARE-SOFTWARE COMPLEX FOR SUPERVISION AND TSUNAMI IDENTIFICATION IN COASTAL ZONE IN LOCAL TSUNAMI WARNING SYSTEMS . ...

Еще в разделе: (Показать все результаты (>3) - seac47-2.phys.msu.ru/ )

... по всему сайту по геол. сайтам в каталоге в форумах в словаре в конференциях . ... Конференции: Календарь / Материалы . ... Геология >> Геохимические науки | Анонсы конференций . ... П.Ю. Плечов / Геологический факультет МГУ . ... 26.11.2003 | ... РОССИЙСКАЯ АКАДЕМИЯ НАУК КАРЕЛЬСКИЙ НАУЧНЫЙ ЦЕНТР ИНСТИТУТ ГЕОЛОГИИ Петрозаводск, 1317 октября 2003 XIV Молодежная научная конференция, посвященная памяти члена-корреспондента АН СССР К.О.Кратца "ГЕОЛОГИЯ И ГЕОЭКОЛОГИЯ СЕВЕРО-ЗАПАДА РОССИИ" ПЕРВЫЙ . ...

Еще в разделе: (Показать все результаты (>19) - phys.web.ru/ )

• Все о геологии :: Анонсы конференций - Геохимия ()
• Все о геологии :: Анонсы конференций - Петрология ()
• Все о геологии :: Анонсы конференций - Вулканология ()

... The degradation of Aluminum-citrate by Pseudomonas fluorescens necessitated a major restructuring of the various enzymatic activities involved in the TCA and glyoxylate cycles. While a six-fold increase in fumarase (FUM EC 4.2.1.2) activity was observed in cells subjected to Al-citrate compared to control cells, citrate synthase (CS EC 4.1.3.7) activity experienced a two-fold increase. ... The activity of CS, FUM, and MS showed marked variations in the control and Al-stressed cells. ...

Еще в разделе: (Показать все результаты (>46) - www.enzyme.chem.msu.ru/ )

• http://www.enzyme.chem.msu.ru/ryabov/pdf/O_98.pdf
• Group of microbial biochemistry and biotechnology

Alexander M. Kuznetsov . ... Sasha Kuznetsov entered a famous Theoretical Department of the Institute of Electrochemistry AN USSR in 1961, and joined Prof. R.R.Dogonadze group, They pioneered the quantum mechanical theory of electron transfer in solutions, which now became a general theory of in chemical, electrochemical and biological systems. ... Concludingly A.M. Kuznetsov is one of the pioneers and creators of quantum mechanical theory of charge transfer processes in condensed media. ...

Еще в разделе: (Показать все результаты (>34) - electr003.chem.msu.ru/ )

• Theoretical Department of the Institute of Electrochemistry AN USSR
• Selected Articles
• Alexander Mikhailovitch Kuznetsov (Sasha)

. Rus / Eng . 0 . 2013 . Impact Factor . Log In or Register . Main . Staff . Publications . Journals . Conferences . Contacts . Main . Staff . Publications . Journals . Conferences . Contacts . Publications . Articles . Back to the list . Inststitutskii per. 9, Dolgoprudnyi 141700, Russia . a-p-ivanov@inbox.ru . Main . Staff . Publications . Journals . Conferences . Contacts . Institute of Computer Science Izhevsk, 2005 - 2016 .

Еще в разделе: (Показать все результаты (>38) - ics.org.ru/ )

• Institute of Computer Sciences - Staff - Korotkov Alexander G.
• Institute of Computer Sciences - Staff - Shaura Alexander S
• Institute of Computer Sciences - Staff - Kilin Alexander Alexandrovich