... You have to choose only one answer among the suggested options; for tasks 1-4 write down `agree' beside the answer you choose. ... Peptide bond between amino acids in a molecule of protein is underlaid by: a) b) c) d) the principle of complementarity; insolubility of amino ac ids in water; solubility of amino acids in water; the presence of carboxy and amino group; Task 2. ... There are ten cards, each with one side white and one side black. ... What is your understanding of the word "progress"? ...

Еще в разделе: (Показать все результаты (>59) - www.psy.msu.ru/ )

• Second Announcement
• Мы благодарим...
• We are grateful

... Query= sp|P0AAI3|FTSH_ECOLI Cell division protease ftsH OS=Escherichia coli (strain K12) GN=hflB PE=1 SV=1 (644 letters) Database: pm 204 sequences; 2,269,587 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE006080 Pasteurella multocida subsp. multocida str. Pm70 sectio.. ... Pm70 sectio... 48 2e-06 AE006234 Pasteurella multocida subsp. multocida str. ... Pm70 section 47 of 204 of the complete genome. ...

Еще в разделе: (Показать все результаты (>630) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~alexus/projects/moeb_homologs.txt
• http://kodomo.cmm.msu.ru/~golikov_v/practices/p77791.out
• http://kodomo.cmm.msu.ru/~anuta_al/projects/rec-pm

... Н.Н.САМУСЬ . ПЕРЕМЕННЫЕ ЗВЕЗДЫ . ... Глава I. ОБЩИЕ СВЕДЕНИЯ О ПЕРЕМЕННЫХ ЗВЕЗДАХ . ... Понятие переменной звезды. ... История каталогов переменных звезд. ... Структура Общего каталога переменных звезд. ... переменных звездах. ... Глава II. ... Классические цефеиды . Типы по ОКПЗ: DCEP, DCEPS, CEP(B). ... Долгопериодические переменные звезды. (глава написана Г.М. Рудницким) . ... Переменные типа RR Лиры. ... ВЗРЫВНЫЕ И НОВОПОДОБНЫЕ ПЕРЕМЕННЫЕ ЗВЕЗДЫ . ... Новые и карликовые новые звезды . ...

Еще в разделе: (Показать все результаты (>10) - heritage.sai.msu.ru/ )

• М.Б.БОГДАНОВ - ИСПОЛЬЗОВАНИЕ РЕСУРСОВ СЕТИ ИНТЕРНЕТ ПРИ ИЗУЧЕНИИ АСТРОНОМИИ
• Конспект лекций по радиоастрономии. Содержание
• Атомная физика; Ю.К.Земцов, К.В.Бычков. Учебник по атомной физике.

... Неорганического материаловедения . ... Направленного Неорганического Синтеза . ... Общие принципы неорганического синтеза . Синтезы некоторых классов неорганических соединений . ... A.V.Shevelkov, E.V.Dikarev, R.V.Shpanchenko, B.A.Popovkin. ... J. Solid State Chem. 1995, v.116, 379-384. G.V.Khvorich, A.V.Shevelkov,V.A.Dolgikh, B.A.Popovkin. ... J. Chem.Soc., ... First tin pnictidehalides Sn 24 P 19,3 I 8 and Sn 24 As 19,3 I 8 : synthesis and the clathrate-1 type of the crystal structure. ...

Еще в разделе: (Показать все результаты (>14) - www.inorg.chem.msu.ru/ )

• Group of Hydrothermal Synthesis :: Links
• Группа гидротермального синтеза :: Ссылки
• Prof. B.A.Popovkin Memorial page

... Results of experimental and numerical investigations of a permeable round parachute with the stripe-stabilizer, the so called "SAL" parachute - Stabilization of Aerodynamic Loads, are given [1]. ... The parachute canopy attained different shapes from each other depending on the value of reefing ( Fig.1 ). ... As given below some numerical investigations of the stripe-stabilizer reefing influence on the canopy shape, its aerodynamic drag and the tension of radial ribbons are considered. ...

Еще в разделе: (Показать все результаты (>2) - margaret.imec.msu.ru/ )

Руководство кафедры . ... профессор, академик, зав. кафедрой . Тел. 939 55 64, Ком. ? ... e-mail: zolotov@analyt.chem.msu.ru . ... РАН, зам. зав. кафедрой по НИЧ . ... к.х.н, доцент, зам. зав. кафедрой по общим вопросам . ... к.х.н, ст.н.с, секретарь кафедры по научной работе . ... к.х.н., доцент, секретарь кафедры по учебной работе . ... профессор, д.х.н. Тел. ... к.х.н., доцент . ... к.х.н., доцент, ученый секретарь Диссертационного совета . ... к.х.н, доцент, зав. практикумом . ...

Еще в разделе: (Показать все результаты (>8) - analyt.chem.msu.ru/ )

• Molecular mechanics study of the mixed-ligand lanthanide complexes using
• Molecular Mechanics Calculations of beta-Diketonate, Aqua, And

Описание вакансии: . Vacancy: R Scientist, PhD (m/f) . ... Demonstrate and maintain expert knowledge in this scientific field. Act as a subject matter expert and technical resource for the organization, in close cooperation with teams all over the world (mainly in USA). ... PhD in catalysis-related chemistry field (Organic Chemistry, Organometallic Chemistry, Inorganic Chemistry, or Chemical Engineering). ... список всех вакансий . добавить вакансию . редактировать эту вакансию . ...

Еще в разделе: (Показать все результаты (>19) - www.chemport.ru/ )

• "R scientist/expert in catalysis-related chemistry, phd (m/f)" - вакансия в
• "Applied r filtration manager, phd, belgium" - вакансия в разделе "Работа для

... DELC - Dictionary of English Language and Culture. ... 1995. ... B 1992 1995 Red Square [ ], home []. 1995 1998 winter []. 1992 1998 soul [], motherland [], culture [], poor/poverty [/], crisis []. , 1998 poverty [] (.: 1992 poor [] ). 1998 birch-trees [], Pushkin [], rouble [], caviar [], mafia [], no good roads [], songs [], puzzling [], unpredictable [], villages [], chastushkas []. -, , 1995 1998 winter [], 1992 1998 ( ) , , , (poor/poverty [/], crisis []) : motherland [], culture [], soul []. ...

Еще в разделе: (Показать все результаты (>58) - ffl.msu.ru/ )

• http://www.ffl.msu.ru/students/courses/fl-teaching/2-basova-general-english-2-lmkk-year.pdf
• Наш факультет

NEW CATALOGUE OF SUSPECTED VARIABLE STARS. ... Moscow: Nauka Publishing House (1982)> ================================================================================ http://www.sai.msu.su/groups/cluster/gcvs/nsv/ ftp ftp.sai.msu.su/pub/groups/cluster/gcvs/nsv/ (anonymous) gcvs@sai.msu.ru INTRODUCTION This catalog is a compilation of 14811 stars suspected of variability and not finally designated as variables prior to 1980. ... We present a preliminary version for 3500 stars from NSV. ...

Еще в разделе: (Показать все результаты (>34) - sai.msu.ru/ )

• http://www.sai.msu.ru/gcvs/gcvs/nsv/readme.new
• GCVS Research Group: Recent publications

... Only by numerical simulation. ... moment T (K) Dipole moment (D) Experiment Other example: Diffusion constant 200 250 298 350 400 2.40 2.37 2.48 2.59 2.80 2.25 The Distribution functions: radial distribution function 1 g (r) = N t =1 j i N TS N pair ( r - rij ) The Distribution functions: radial distribution function CC def 2 Work mode ­ computer related 1) · Perform simulation , create trajectory file · Calculate properties timestep by timestep 2) · Perform ...

Еще в разделе: (Показать все результаты (>6) - www.elch.chem.msu.ru/ )

• Molecular aspects of solid state and interfacial electrochemistry

Program XXXVI International Conference of the Russian Society for American Culture Studies Nature and Sustainability of Culture Moscow, December 3-10, 2010 Section 1. ... Nature in the nineteen-century American culture (The concept of Nature and its evolution from Romanticism to Naturalism. ... O.Y. Danchevskaya Moscow State Pedagogical University, Moscow, Russia Concept of Soul among North American Indians Soul is probably the most vital notion in any religion, though ideas about it vary greatly. ...

Еще в разделе: (Показать все результаты (>13) - www.journ.msu.ru/ )

• The 5th International Media Readings in Moscow "Mass Media and Communications ?
• About MSU :: Department of Journalism, M. V. Lomonosov Moscow State University

РЕЛЯЦИОННЫЕ БАЗЫ ДАННЫХ с.н.с А.С. Козицын 1/2 года, 3-5 курс 1. Реляционная база данных. ... Применение логических операций и операций теории множеств для выборки необходимых данных из базы. ... Разработка базы данных в ERWin. Основы использования одного из наиболее современных CASE средств для проектирования схем баз данных. ... К., изд .группа DHV, 1998. [оригинал: Dave Ensor and Jan Stevenson. ... 1997.] ... К., изд-во "ДиаСофт", 1998. [оригинал: Advanced Information Systems, INC., et al. ...

Еще в разделе: (Показать все результаты (>8) - new.math.msu.su/ )

... Корпорация AMD (США) подарила к Татьяниному дню механико-математическому факультету МГУ компьютерный класс из 10 компьютеров и сервера на базе процессоров AMD Athlon. 24 января с.г. во II учебном корпусе МГУ состоялись пресс-конференция для журналистов и торжественное открытие класса. ... Компьютерный класс создан на базе лаборатории проблем теоретической кибернетики при кафедре математической теории интеллектуальных систем (заведующий кафедрой МаТИС и лабораторией ПТК - академик Кудрявцев В.Б. ) . ...

Еще в разделе: (Показать все результаты (>5) - www.intsys.msu.ru/ )

English-speaking countries» Test Your Knowledge of Great Britain 2009 © - ©.. ... 49 4 GEOGRAPHY 1) How many parts does Great Britain consist of? a) 5; b)4; c)6; d)3. 2) What is the area of Great Britain ? ... 9)What is the name of the river flowing along the border of England and Scotland? a)the Tweed; b)the Severn; c)the Great Ouze; d)the Eden. ... 26) How many animal species are there in Great Britain? a) over 40,000; b)30,000; c)35,000; d)12,000. ... British colonies. a)8; b)5; c)10; d)13. ...

Еще в разделе: (Показать все результаты (>5) - www.eng.math.msu.su/ )

... Size: 32 x 31 е It = + 3.37 nA Vt = +2.0 mV 2 (1x1) Cu( 110 ) UHV UHV (1x2) Size: 75 x 73 е It = +1.42 nA Vt = +105.0 mV 2 Chamber and STM design Gate valve 0.85 bar Suspension Reactor vessel STM Size: 32 x 31 е It = + 2.65 nA Vt = +1.0 mV 2 1 bar Size: 75 x 73 е It = +1.55 nA Vt = +29.3 mV 2 UHV chamber Top window L. жsterlund et al, to be published Linear transfer rod Valve Main manipulator STM To pump Sample and ...

Еще в разделе: (Показать все результаты (>3) - www.kge.msu.ru/ )

pic] Program of humanitarian aid from Russia Rectors' Union (RRU) to South-Ossetia's Tibilov State University The first batch of humanitarian aid from RRU to South-Ossetia's Tibilov State University was dispatched to Vladikavkaz by Ministry of Emergencies' charter plane at August 27. It included 1612 classical textbooks and manuals, and a modern computer training-room, comprised of 34 units of equipment. ... September 16, another charter plane has delivered the second batch of humanitarian aid. ...

Еще в разделе: (Показать все результаты (>5) - www.rsr-online.ru/ )

• http://www.rsr-online.ru/doc/norm/328.doc

The Early Music Theatre >> Repertoire >> Life of wonderful Mr. Handel . Life of wonderful Mr. Handel . ... GUSTAVUS WALTZ – Handel's cook, a performer of the unique part of Polyphem with a range of three octaves in the opera "Acis and Galatea" and Saul's part in the oratory "Saul". ... One day during the performance of Handel's opera "Giulio Cesare", when Senesino was about to sing "Caesar had never known fear" all of a sudden some scenery fell and Senesino was struck dumb and started crying. ...

Еще в разделе: (Показать все результаты (>2) - www.tsm-msu.ru/ )

Аномалии полового развития амфипод Gammarus pulex (L.), найденных ниже станции для очистки сточных вод. ... С. 1792-1797. ... У самцов амфипод, обитающих ниже очистных сооружений в графстве Суррей (Великобритания), строение гонад, наружные половые признаки и размеры тела были такими же, как на контрольном участке. У самок значительно нарушалась структура ооцитов в вителлоегенезе. Одновременно уменьшалась длина тела самок и отношения размера самцов к размеру самок по сравнению с контролем. ...

Еще в разделе: (Показать все результаты (>5) - ecoinformatica.srcc.msu.ru/ )

• http://ecoinformatica.srcc.msu.ru/print_html.php?keyword=&num_records=1&theme=5&subtheme=22&from=&ref_ind=0412002142

... Identities = 27/91 (29%), Positives = 44/91 (48%) Frame = +2 Query : 9 RFAPSPSGELHFGSLIAALGSYLQARARQGRWLVRIEDIDPPREVPGAAETILRQLEHYG 68 RF P P+G LH G + ++ A QG +R +D +P +E ++I + +E G Sbjct : 3014 RFPPEPNGYLHIGHAKSICLNFGIAEDYQGLCNLRFDDTNPVKEDVEYVDSIKQDVEWLG 3193 Query : 69 LHWDGDVLWQSQRHDAYREALAWLHEQGLSY 99 W+G+ + S D L E+GL+Y Sbjct : 3194 FKWEGEPRYASDYFDQLYGYAIELIEKGLAY 3286 Database : pm Posted date: Oct 28, 2009 6:14 PM Number of letters in database : 2,269,587 ...

Еще в разделе: (Показать все результаты (>447) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/FBB/year_09/term3/Pr_8_AAl.doc

Proteogenomic analysis of bacterial signal peptides Dmitry N. Ivankov1, Samuel H. Payne2, Stefano Bonissone3, Si Wu4, Roslyn N. Brown2, Ljiljana Pasa-Toli4, Matthias Birschenk5, Iris ... Department of Genome-Oriented Bioinformatics, Technische UniversitДt MЭnchen, Freising, Biological Sciences Division, Pacific Northwest National Laboratory, Richland, WA, USA ; Bioinformatics Program, University of California San Diego, La Jolla, CA, ... 2013) How many signal peptides are there in bacteria? ...

Еще в разделе: (Показать все результаты (>30) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/134.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/4.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/120.pdf