... Next Routine] [List of Routines] NAME: ADD_HEADER PURPOSE: addition information from FITS-headers MPFS-frames DESCRIPTION: The function computes the total exposure, mean value zenit distance and modified FITS header CALLING SEQUENCE: Result =ADD_HEADER( headers ) CATEGORY: reduction MPFS-data INPUTS: Headers = String array FITS-headers from the MPFS data OUTPUTS: Header = String array containing the header from the FITS file. ... OPTIONAL INPUT KEYWORD PARAMETERS: BEFORE = Keyword string name. ...

Еще в разделе: (Показать все результаты (>46) - sn.sai.msu.ru/ )

... Parent Directory - 1-1-GeneralTopology-Conspectus-2009.pdf 26-Aug-2009 19:49 189K 1-1-GeneralTopology-Conspectus-Addendum-5-5-2009.pdf 09-Sep-2009 12:56 131K 1-4-Examples-Addendum.pdf 22-Sep-2009 11:50 89K Alexandrov-168-169.pdf 08-Sep-2009 12:36 225K ControlWorks/ 05-Sep-2009 15:50 - FAQ/ 08-Sep-2009 13:53 - Poincare.pdf 08-Nov-2007 15:29 296K Program-2009.pdf 16-Aug-2009 12:31 89K Test1-2009.pdf 28-Aug-2009 15:42 83K UchPr-2009.htm ...

Еще в разделе: (Показать все результаты (>305) - higeom.math.msu.su/ )

• Index of
• Publications (English)
• C*-algebras: Talks

... MASTER Net is 56 square degrees per 1 exposition . ... 06 Dec 2015: GRB 151205B: MASTER-NET early optical observations GCN18665 . ... 18 Nov 2015: GRB 151118A: MASTER-NET optical observations GCN18613 . ... 12 Nov 2015: GRB 151112A: MASTER-NET optical limit GCN18591 . ... 07 Nov 2015: GRB 151107A: MASTER-NET optical observations GCN18565 . ... 31 Oct 2015: Five OTs detected by Global Robotic MASTER Net ATel8232 . ... 02 Oct 2015: GRB 151001B: MASTER-NET early optical observations GCN18380 . ...

Еще в разделе: (Показать все результаты (>21) - observ.pereplet.ru/ )

• Candidate Assignments

Software Protection: How to Crack Programs, and Defend Against Cracking" In the first part of this course we will learn how to "crack" programs, i.e.how hackers break into software to extract secrets, remove license checks, etc. ... Learning about this type of computer security is important because many current systems are vulnerable to cracking attacks. ... The course will have practical homework exercises where you will crack small programs, and use tools to protect against cracking. ...

Еще в разделе: (Показать все результаты (>2) - master.cmc.msu.ru/ )

Plyashechnik A.S. Equivalence of Two Definitions of a Chronological Integral . ... Chirskii V.G. Algebraic Independence over Q p of Values of Analytic Functions at Points from C p . ... Brovko G.L. Models and Problems for Saturated Porous Media . Georgievskii D.V. Growth Estimates of Perturbations in Eigenvalue Problems for the Rayleigh Equation . ... Index of papers and matherials published in the Journal "Vestnik Moskovskogo Universiteta. ... 1, Matematika. Mekhanika" during 2010 year . ...

Еще в разделе: (Показать все результаты (>115) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Instructions

Entropy 2010, 12, 1050-1070; doi:10.3390/e12051050 OPEN ACCESS entropy ISSN 1099-4300 www.mdpi.com/journal/entropy Article Functional Information : Towards Synthesis of Biosemiotics and Cybernetics Alexei A. Sharov National Institute on Aging, 251 Bayview Boulevard, Baltimore ... Published: 27 April 2010 Abstract: Biosemiotics and cybernetics are closely related, yet they are separated by the boundary between life and non- life : biosemiotics is focused on living ... SchrЖ er, E. What is life? ...

Еще в разделе: (Показать все результаты (>419) - chronos.msu.ru/ )

• http://temporology.bio.msu.ru/EREPORTS/anisov_time.pdf
• Эберген Дж. (Еbergen J.)
• Сазерленд И.Е. (Sutherland I.E.)

... AB , 90њ, 180њ 270њ. 1-7 120њ 240њ. ... CD, , 2 A 1 C 4 3 ї йОе?МТНЛИ Д.ы., 1996 6 B 5 . ... D 7 8 114 лйкйлйЗлдав йЕкДбйЗДнЦгъзхв ЬмкзДг, <10, 1996 180њ. ... e', ee' = e' ( e ) ee' = e ( e' ). e' = e. a. b b' - , ) - ) b = be = b(ab') = (ba)b' = eb' = b', йгътДзлдав Д.ы. ЙкмиийЗхЦ алуалгЦзаь 115 b = b'. : b = a -1. . ... G x ax = b (1) (x0 , y0 , z0) xyz = b x0 y0 , az = b, a = x0y0 , z0 . ... йгътДзлдав Д.ы. ЙкмиийЗхЦ алуалгЦзаь 117 , , , , . ... йгътДзлдав Д.ы. ЙкмиийЗхЦ алуалгЦзаь 119 ...

Еще в разделе: (Показать все результаты (>114) - nuclphys.sinp.msu.ru/ )

• http://nuclphys.sinp.msu.ru/school/s08/s08_17.pdf
• http://nuclphys.sinp.msu.ru/conf/lpp14/220809/Nemchenko.pdf
• Introduction to group theory

... Географии мирового хозяйства . ... Выберите кафедру . ... РЖ "Geography, Environment, Sustainability" . ... Учебно-методический отдел . ... Кафедра географии мирового хозяйства . Кафедра геохимии ландшафтов и географии почв . ... Кафедра физической географии и ландшафтоведения . ... НИЛ возобновляемых источников энергии . ... Kalutskov V.N. To the representation of cultural landscape. ... Mikhailov V.N., Gorin S.L., Mikhailova M.V. New approach to the definition of estuaries and to their typology. ...

Еще в разделе: (Показать все результаты (>205) - www.geogr.msu.ru/ )

• CONTENTS ?2 - 2009
• Instructions for Authors, contributing to “GEOGRAPHY, ENVIRONMENT,

... solvation nucleation of the polymorphs Solute-solute interactions, association parameters , thermodynamics parameters , conformations growth of the crystal Nature of solvent, intermolecular interactions (solute ­ solvent, solute-solute), conformations Lattice energy , entropy of the crystal, symmetry of the lattice, conformations The conformational manifolds is the candidate to be a coordinate of reaction Methods of investigations Quantum chemistry ...

Еще в разделе: (Показать все результаты (>12) - www.elch.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/mole/lecture/probst.pdf
• Molecular aspects of solid state and interfacial electrochemistry

... TEX METAFONT , TEX - . ... TEX; Internet ftp://sunsite.unc.edu/pub/academic/russianstudies/Software/PSfonts/pscyr.tar.gz. ... AcademyPSCyr), Regular , Bold , Italic · (HandbookPSCyr), Regular , Bold , Italic · (CollegePSCyr), Regular , Bold , Italic · (AntiquaPSCyr), Regular , Bold , Italic · (Lazurski), Regular · (TimesNewRomanPSMT), Regular , Bold , Italic , Bold Italic : · (ArialMT), Regular , Bold , Italic , Bold Italic , Black · (TextbookPSCyr), Regular , Bold ,...

Еще в разделе: (Показать все результаты (>5) - scon155.phys.msu.ru/ )

... N.M. Emanuel Institute of Biochemical Physics, Russian Academy of Sciences . A.N. Bach Institute of Biochemistry, Russian Academy of Sciences . Advanced Biomedical Computing Center , National Cancer Institute at Frederick, MD, USA . Department of Chemistry, University of Southern California , Los Angeles, CA, USA . Department of Biomolecular Mechanisms, Max-Planck Institute for Medical Research, Heidelberg, Germany . ... Joint Supercomputer Center of the Russian Academy of Sciences . ...

Еще в разделе: (Показать все результаты (>16) - lcc.chem.msu.ru/ )

• Current Projects
• Laboratory of Chemical Cybernetics
• People

... Department . ... Courses . ... Course Name . ... Prof. Fedor S. Zaitsev . ... Prof. Alexander M. Popov . Visualization in Scientific Research . ... Assoc. Prof. Igor N. Inovenkov . Mathematical Models for Dynamic Processes . ... Prof. Vladimir V. Nefedov . ... Prof. Igor V. Zotov . ... One-Dimensional Problems of Mathematical Physics . ... Prof. Alexander P. Smirnov . Two-Dimensional Problems of Mathematical Physics . ... 2008?2016 ASR Department , CMC Faculty , Lomonosov MSU . ...

Еще в разделе: (Показать все результаты (>14) - ani.cmc.msu.ru/ )

• The ASR Department at the CMC Faculty of Lomonosov MSU | Department of the
• Department of the Automation for Scientific Research CMC MSU | Computational
• Courses

... Таня Трубичева, Коля Чеботарев, Сергей Меженный, Андрей Лебедев . ... Слева направо: Паша Зинюков, Булат Мавлюдов, Галя Ивутина (выше), Муся Григорян, Саша Игнатьев. ... Слева направо: 1)Аня Ноздрачева, 2)Дима Китаев, 3)Миша Ноздрачев, 4)Женя Цибиков, 5)Костя Фирсов, 6)Володя Трифонов, 7)Тамара Голубицкая, 8)Таня Михайлина, 9)Саша Игнатьев, 10)Валя Рябинкина, 11)Таня Чеботарева, 12)Оля Гусева, 13)Коля Чеботарев. ... Таня Гужва, Таня Немченко, Даниэль Усиков перед спуском в снежную . ...

Еще в разделе: (Показать все результаты (>10) - optics.sinp.msu.ru/ )

• polist99
• zagedan

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>281) - monkey.belozersky.msu.ru/ )

• ETS numeration assumed
• Internet Services
• Example of supporting positions

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... Lomonosov Moscow State Univ Research Center "Computer Science and Control" of RAS (FRC CSC RAS) Operations Research Society (RSORS) will organize the VIII Conference in Octo Operations Research. theoretical aspects and ersity (MSU), Federal and Russian Scientific ber 2016 in Moscow. ... Deadline for abstract submissions is March 31, 2016. ... Conference website: http://io.cs.msu.ru/ORM2016.html. ... Selected extended abstracts will be published in the Conference proceedings. ...

Еще в разделе: (Показать все результаты (>18) - io.cmc.msu.ru/ )

• http://io.cs.msu.ru/ORM2016/ORM2016-2nd_announ-ENG.pdf
• http://io.cs.msu.ru/ORM2013/ORM2013-2nd_ann-ENG.pdf
• Кафедра Исследования Операций

University Satellites and . Space Science Education . ... The computer-based practical stereo measurements training course in the aerospace education for the students of geographical specialities . ... The two main systems are the computer-based stereocomparator supporting visual stereo measurements at the monitor of a personal computer and the research stereo correlation utility for automated measurements of the aerial and satellite images for digital elevation models construction. ...

Еще в разделе: (Показать все результаты (>46) - cosmos.msu.ru/ )

• UNIVERSAT-2006 presentations

... Although it is true that geologists call a lithified sand a sandstone regardless of age or hypothetical origin, it is equally true that degree of lithification plays no part in the stratigraphy of sediments. ... If you are describing a lithified sedimentary sequence with buried soils, it stands to reason that they would be lithified too. ... A geosol has to be buried where it is defined; otherwise, its stratigraphic position cannot be recognized. ...

Еще в разделе: (Показать все результаты (>152) - www.fadr.msu.ru/ )

• http://www.paleopedology.msu.ru/discussions/messages/255.html
• SOILS, PALEOSOLS, AND GEOSOLS: A Commentary
• anons2_e

Кафедра высокопроизводительных вычислений МГУ . Главная . ... Главной задачей кафедры является организация и осуществление на высоком уровне учебно-воспитательной работы по подготовке специалистов высокой профессиональной квалификации по высокопроизводительным вычислениям на многопроцессорных ЭВМ из числа студентов 2-5 курсов механико-математического факультета , физического факультета , факультета вычислительной математики и кибернетики, химического факультета и других факультетов ...

120. Olga I. Vinogradova