include stdio.h #include math.h double fdet ( float d, float c, int n ); int fau ( float d, float c, int n, double ua[] ); void fld ( float d, float c, int n, double ld[] ); void fv ( int n, double vld [] ); void main() { int i, i1, j, j1, n = 5 ; float d = 2., c = 1., det ; double ld[ 10 ], ua[100], vld [100]; ...

Еще в разделе: (Показать все результаты (>540) - num-anal.srcc.msu.ru/ )

• http://num-anal.srcc.msu.su/meth_mat/prac_alg/arfil/symfor1.txt
• БЧА НИВЦ МГУ. ZF30R. Решение системы уравнений общего вида
• БЧА НИВЦ МГУ. IA80R_C. Аппроксимация рациональными функциями (равномерная)

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

... 2 · ­ , , · ­ · ­ , 03.12.2015 . ... 14 03.12.2015 · · · 03.12.2015 . ... Verifier Uni ve rsi ty of Te x as 2013 Anteater Uni ve rsi ty of Il l i noi s 2011 FlowChecker Uni ve rsi ty of North Carol i na 2010 VERMONT Network disjoint Port #02 Port #03 h2 h3 s1 Port #01 h1 Port #04 h4 main: disjoint() := Forall[x, out_x, y, out_y: !R(x, out_x) or !R(y, out_y) or x[p] == out_y[p] and out_x[p] == y[p] or x VERMONT proxy CLI Packets are delivered through the control plane We can block them! ...

Еще в разделе: (Показать все результаты (>6) - lvk.cs.msu.su/ )

... Documentation and description of the Northern Selkup local dialects: the situation of language shift // Congresus XI Internationalis Fenno-ugristarum Piliscsaba 2010. Pars III. Piliscsaba, 2010. ... 116-117. ...

Еще в разделе: (Показать все результаты (>40) - srcc.msu.ru/ )

• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should

... DESCRIPTION General Catalog of Variable Stars (GCVS database) . ... Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1990, General Catalogue of Variable Stars, 4rd ed., vol.IV, Nauka, Moscow. Kholopov P.N., Samus N.N., Durlevich O.V., Kazarovets E.V., Kireeva N.N., Tsvetkova T.M., 1992, General Catalogue of Variable Stars, 4rd ed., vol.IV, Bull. ... Kazarovets E.V., Durlevich O.V. Editor-in-Chief Samus N.N., 1998, New Catalogue of Suspected Variable Stars. ...

Еще в разделе: (Показать все результаты (>79) - sai.msu.ru/ )

... While Russia is currently committed to solving the problems of the previous century, more prosperous countries are focusing on securing the prerequisites for global leadership in the 21st century on the basis of their own national interests.? ... One of their main responses has been a global competence mission through international education, and especially study abroad programs. ... Roughly 500,000 international students are currently studying in the United States at the postsecondary level. ...

Еще в разделе: (Показать все результаты (>84) - www.prof.msu.ru/ )

• One effective method to turn passive students into active learners in Russian
• Discovering America
• HUMAN RIGHTS AND DEVELOPMENT

... if (B1) { S1; } if (B1) { S1; } if (B2) { S2; } - - ...exp... int x = 1; if (x == 1) { std::cout << "Okay" << std::endl; } else { std::cout << "Error" << std::endl; } -- ­ int strlen(const char* p) { int len = 0; do { ++len; } while (*p++); return len; } «», «bbb» -- , : · ­ , , · ­ , , · ­ , · ­ . ... 1977 ­ LTL, · , 1981 ­ (CTL), · , , 1981 , , 1982 ­ model checking ( ), · , 1986 ­ model checking ( ), · , 1989 ­ SPIN. ... The Spin Model Checker: Primer and Reference Manual, Addison Wesley, 2003. ...

Еще в разделе: (Показать все результаты (>3) - savenkov.lvk.cs.msu.su/ )

• http://savenkov.lvk.cs.msu.su/mc/lect02.pdf

... Микс 193 A 131 A 171 A 211 A 304 A Корона Магнитограмма . 211 + 193 + 171 . Description . ... LASCO (Large Angle and Spectrometric Coronagraph)- инструмент на космическом аппарате SOHO, поставляющий изображения солнечной короны, на которых свет, идущий непосредственно от Солнца, заблокирован с помощью искусственного затмения, создаваемого самим аппаратом. ... The form and the location of the magnetospheric boundary are defined by pressure balance of the solar wind and geomagnetic field. ...

Еще в разделе: (Показать все результаты (>1230) - swx.sinp.msu.ru/ )

... You have to choose only one answer among the suggested options; for tasks 1-4 write down `agree' beside the answer you choose. ... Peptide bond between amino acids in a molecule of protein is underlaid by: a) b) c) d) the principle of complementarity; insolubility of amino ac ids in water; solubility of amino acids in water; the presence of carboxy and amino group; Task 2. ... There are ten cards, each with one side white and one side black. ... What is your understanding of the word "progress"? ...

Еще в разделе: (Показать все результаты (>139) - www.psy.msu.ru/ )

• http://www.psy.msu.ru/science/psyrussia/2009/suprun.pdf
• http://www.psy.msu.ru/science/psyrussia/2009/kozlov.pdf
• http://www.psy.msu.ru/science/psyrussia/2012/filipieva.pdf

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>14) - tukachev.flogiston.ru/ )

• Category: Новости

... Dear second-year students, let me congratulate you on the beginning of the new academic year and also with the new year of ?interesting? programming! You can find information concerning schedules and groups on our site under tab Schedule and Groups. ... However, if you don?t have any questions, come straight to the first class according to the schedule. All classes, except for Introduction to Linux will begin this week. ...

Еще в разделе: (Показать все результаты (>19) - engineering.phys.msu.ru/ )

• Circuit Diagnostics
• Introduction to Linux
• Noise Meter

... Course "Computer Physics" for 1st and 2nd year students of Physics . ... The audience is 1st and 2nd year students of Physics. ... It consists of a short lecture course, seminars, and a large number of computer labs. ... 1985-1994 : Lectured a specialized course on "Computer Physics"for the 3rd year students of Physics, Department of Physics, and attendees of the continuing education department, International Laser Center of Moscow State University. ... 2016 Quantum Information Laboratory. ...

Еще в разделе: (Показать все результаты (>74) - qilab.phys.msu.ru/ )

... High Brightness RTM . ... Fig.1a: 70-MeV pulsed race-track microtron . Many applications require compact, inexpensive and efficient source of electron beam in energy range 10-100 MeV. ... Beam is focused by accelerating structure, which acts as RF quadrupole singlet, quadrupole triplets (12) installed at the even orbits return path and by electromagnet quadrupole singlet (9) installed at common axis. ... Fig.1b: 70-MeV RTM Schematic . ... Energy gain: 4.8 MeV / orbit . Orbits: 14 . ...

Еще в разделе: (Показать все результаты (>3) - vserv.sinp.msu.ru/ )

... Parent Directory 27-Oct-2014 15:02 - 400.jpg 04-Apr-2005 16:47 657k IMG_3762.JPG 23-Mar-2006 16:32 1.3M M33big.jpg 27-Jul-2006 18:02 419k M33sm.jpg 27-Jul-2006 18:01 157k PL_COLL.htm 26-Jul-2006 22:46 38k Scanner.jpg 09-Dec-2005 14:31 1.2M Scanner2.jpg 27-Jul-2006 18:08 65k alla.gif 26-Jul-2006 23:36 54k clipboard.gif 25-Jul-2002 20:01 2k digit .gif 26-Jul-2006 21:37 6k digit .html 06-Dec-2011 18:17 4k mdv/ ...

Еще в разделе: (Показать все результаты (>24) - www.sai.msu.ru/ )

• Index of /groups/cluster/gcvs/digit/mdv

Программирование диалогов 1. ... Написание диалоговой функции: float dedit = 0.; BOOL CALLBACK DialogProc (HWND hDlg ,UINT uMsg, WPARAM wParam ,LPARAM lParam) { char str [80]; switch (uMsg) { case (WM_INITDIALOG): sprintf( str , %5.2f , dedit ); SetDlgItemText( hDlg ,IDD_EDIT, str ); //CheckDlgButton( hDlg ,IDD_RED, TRUE ); return TRUE ; case WM_COMMAND: switch (LOWORD ( wParam )) { case IDOK: GetDlgItemText( hDlg ,IDD_EDIT, str ,80); //IsDlgButtonChecked( ...

Еще в разделе: (Показать все результаты (>64) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/science_education/lections/CS/cp/First.pdf

MSU . Science Park . ... Venue & Space . ... At Moscow State University Science Park, the laboratory and administrative offices are available to hire by innovative companies on a long or short term basis. ... MSU Science Park is situated in a picturesque area of Moscow, close to the MSU Botanical Garden on Sparrow Hills. With eight, two-storey buildings of 500 m 2 each on the site plus a four-storey building with an area of 7,500 m 2 , there is a total building area of 11,500 m 2 . ...

Еще в разделе: (Показать все результаты (>6) - www.sciencepark.ru/ )

• MSU Science Park - About us

. Name . Last modified . Size . Description . about_center/ . 14-Sep-2013 14:31 . - . sections/ . 31-Oct-2007 14:46 . - . Apache/2.2.16 (Debian) Server at educenter.sinp.msu.ru Port 80

Еще в разделе: (Показать все результаты (>9) - educenter.sinp.msu.ru/ )

• Index of /about_center/workplaces

Visual Images of Patriarch Nikon: An Electronic Gallery" consists of nearly fifty artistic depictions of patriarch Nikon and their full bibliographic citations. 2 The gallery evolved out of my dissertation "Patriarch Nikon's Image in Russian History and Culture" (Western Michigan University, 2004) and embodies my main argument that Nikon's resonance in Russian history remains largely unrecognized because traditional histories ? ... Nikon was officially rehabilitated shortly thereafter in 1682. ...

Еще в разделе: (Показать все результаты (>137) - hist.msu.ru/ )

• Dr. Michelle Marrese's Course "Women in the Age of Enlightenment"
• Corporate Social Policy as an Approach to Managing the Workforce: Some Examples
• "Novaya i noveishaia istoria" Journal