FAST RANK ALGORITHMS WITH MULTISCALE HISTOGRAMS LAZY UPDATING1 M. Storozhilova2, D. Yurin 2,3 3 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia. mariastorozhilova@gmail.com2, yurin@cs.msu.su3 Rank algorithms propose good solutions for image smoothing and impulse noise removing. ... The main idea of our lazy algorithm is based on histogram updating approach from [2]. ...

Еще в разделе: (Показать все результаты (>130) - imaging.cmc.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2011.VCIP.Krylov_Sorokin.KeyP.en.pdf
• http://imaging.cs.msu.ru/pub/2011.ICIAR.Sorokin_Mizotin_Krylov.GaussLaguerreKeypoints.en.pdf
• http://imaging.cs.msu.ru/pub/2011.Graphicon.Zipa_Ignatenko.MetallicCoating.en.pdf

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>22) - antares.sinp.msu.ru/ )

... Conformational Analysis of Boron-Containing Compounds Using Gillespie-Kepert Version of Molecular Mechanics . ... Abstract - Molecular mechanics force field for boron-containing compounds based on CHARMM parameters and Gillespie-Kepert (GK) model is developed. ... The force field provides an accurate description of experimental X-ray stereochemistries in a wide range of organoboranes, organoborate complexes with polyhydroxy compounds, mixed oligomers of boric acid and borates. ...

Еще в разделе: (Показать все результаты (>50) - analyt.chem.msu.ru/ )

• Study of amino- and pyridyl-containing zinc(II) and cadmium(II) complexes by
• Moscow State University: Analytical Chemistry Division

... The earlier meaning assigned to ca- was `to set up, dedicate', while C. Melchert believes that verbs formed from this root can mean both `to promise, pledge' and `to agree, assent'.7 The verbal root o- also seems to refer to some sort of verbal activity.8 The root of the cognate stems i- and in- is probably the same as that of Hitt . ie- and Luw. - `to do, make', and the meaning of the Hittite and Luwian verbs suits the appropriate Lydian contexts.9 ... 7 Melchert 1997: 39-41. ... EWL ~ Lyd...

Еще в разделе: (Показать все результаты (>17) - imk.msu.ru/ )

• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/palaic1.pdf
• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/Hieroglyphs.pdf
• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/luwian.pdf

... REVIEWS Measurement and Physical Content of Quantum Information B. A. Grishanin and V. N. Zadkov Received January 15, 2002 Abstract--Basic quantum information measures involved in the information analysis of quantum systems are considered. ... But today, it has become possible to intentionally vary directly quantum states of elementary quantum systems. ... 9 2002 MEASUREMENT AND PHYSICAL CONTENT OF QUANTUM INFORMATION 935 its information-equivalent copy is at the input and output. ...

Еще в разделе: (Показать все результаты (>74) - qilab.phys.msu.ru/ )

• http://qilab.phys.msu.ru/papers/JETP-1996-82(6)-en.pdf
• http://qilab.phys.msu.ru/papers/LasPhys-2000-10(6)-en.pdf
• http://qilab.phys.msu.ru/papers/JETP-2000-91(5)-en.pdf

The laboratory is engaged in fabricating high-efficiency catalysts and working out theoretical descriptions of kinetics and mechanisms of the processes which takes place in chemical power sources. ... The kinetics of electrooxidation of some simplest organic fuels is investigated, which is of interest for electrochemical generators. ... B.I.Podlovchenko, E.A.Kolyadko, Lu Shigan, Specific Features of Hydrogen Sorption by Pd Dispersed Forms at a-Phase Potentials // J.Electroanal. ...

Еще в разделе: (Показать все результаты (>14) - www.elch.chem.msu.ru/ )

... Выпускники . ... Программа международных грантов American Association of University Woman предназначена для женщин с университетским образованием (студенток, аспиранток, специалистов со степенью). ... Выделяется также несколько грантов (размером от $5,000 до $7,000 каждая) для реализации проектов тех участников Программы международных грантов American Association of University Woman, которые были стипендиатами программы в 2001-2005 гг. ... Master's/First Professional Fellowship $18,000 . ...

Еще в разделе: (Показать все результаты (>560) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Обсуждение материала "American Association of University
• Клуб выпускников МГУ: CRISIS IN THEORETICAL PHYSICS: THE PROBLEM OF SCIENTIFIC
• Клуб выпускников МГУ: Внутримышечные инъекции - главная надежда на излечение от

... education . research . ... Fundamentals of Nanotechnology . ... Molecular physiology . ... Pass/fall exam: 5 p.m., 22 May, 2009 (those third-year students who pass the exam undertake further study majoring in Nanosystems and Nanodevices , Functional Nanomaterials , Nanobiomaterials and Nanobiotechnology). ... 10 February 2009 . ... Prof. Yu. ... Work of molecular motors: ATP synthetase, photosynthetic reaction centers, retinal containing photosensitive proteins (rhodopsin, bacteriorhodopsin.) ...

Еще в разделе: (Показать все результаты (>17) - nano.msu.ru/ )

• Fundamentals of Nanotechnology, 2009 | Научно-образовательный центр по
• Composite Nanomaterials Master?s Program | MSU Nanotechnology Education and
• Announcement about the admission to MSU Graduate School for a new Master?s

Annotation to the diploma of Aleksei Konjashkin Peculiarities of generation and amplification of diode pumped Nd:YAG picosecond laser The aim of diploma is the estimation of focal length of thermal lens arising in active element depending from the diode pump pulses rate and energy. ... The next aim was the calculation and adjustment of compact two pass amplifying system and comparison of the characteristics of two amplifiers of picosecond pulses with lamp and diode pump. ...

Еще в разделе: (Показать все результаты (>135) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2007/Kostylev_Cherezova_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2016/Bychkov_Karabutov_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2008/Bulushova_Romanovsky_en.pdf

Post-Telbessian Strike-Slip-Related Compressional and Extensional Structures in Central Kazakhstan . ... Faults controlled post-telbessian structuring are of Late Devonian - Early Permian age; they are usually deep-seated. ... Thus, post-telbessian structure of Central Kazakhstan has developed under condition of relatively monotonous stress field with sub-longitudal orientation of main compression and latitudal orientation of main extension. ...

Еще в разделе: (Показать все результаты (>17) - sbmg.geol.msu.ru/ )

• Список элементов HTML
• Специальные символы HTML

Development of new approaches to the analysis of ring shapes in organic molecules and the description of electronic distribution (atomic charges) and halogen bonding in the framework of forcefield model for rapid estimation of intra- and intermolecular interaction energies in molecular mechanics, molecular dynamics and docking methods . Forcefield is a model and a set of parameters for theoretical description of intra- and intermolecular interactions. ... 2016 Laboratory of Medicinal Chemistry ...

Еще в разделе: (Показать все результаты (>5) - qsar.chem.msu.ru/ )

... A comparative study of thermodynamic for both natural and artificial RNA/DNA ґ protein complexes would establish bases for a specificity of complex formation. In particular, we have shown that aptamers could be used for a direct measuring of thrombin enzymatic activity in a solution. D 2002 Published by Elsevier Science B.V. Keywords: RNA/DNA ґ protein interactions; Ribosome; SELEX; RNA/DNA aptamers; Thrombin; Enzymatic activity 1. ... The aptamer binds to the protein with Kd = 0.5 nM. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2002_1.pdf
• http://rnp-group.genebee.msu.su/pdfs/febsz.pdf

Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales (Описание ролей Проппа в русской волшебной сказке) // Обработка текста и когнитивные технологии: сб. статей. ... 19: Труды XII Международной научной конференции (Дубровник, 7-14 сентября 2010 г.). Казань: Казан. гос. ун-т, 2010 (реально сборник вышел в 2011 г.). С. 77-79. ...

Еще в разделе: (Показать все результаты (>110) - srcc.msu.ru/ )

• Kazakevich, Olga. Endangered Languages Documentation and Description: Should
• Kazakevich, Olga. Documentation and description of the Northern Selkup local
• Bazhanova Z.G., Oganov A.R, Gianola O.. Fe-C and Fe-H systems at pressures of

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom2_2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/batmas30.pdf

... Book 1 Containing the years from the beginning of the World, or from the year of the Juliam Period 730 unto the third of Solomon, which is the 3702 year of the same Period . ... Book 5 Containing years from the first of CHRIST to the Thirty fourth . Book 6 Wherein are contained the years from the 304 of CHRIST unto 491 . Book 7 Wherein are contained the years from the 491 of CHRIST unto 641 . Book 8 Wherein are contained the years from the 641 of CHRIST unto 1100 . ...

Еще в разделе: (Показать все результаты (>98) - hbar.phys.msu.ru/ )

• The jump of the second derivative of the moon's elongation

The Octotron Approach: Towards Autonomous and Reliable Operation of Supercomputers Alexander Antonov, Dmitry Nikitenko, Pavel Shvets, Sergey Sobolev, Konstantin Stefanov, Vadim Voevodin, Vladimir Voevodin, Sergey Zhumatiy Research Computing Center, Lomonosov Moscow State University, Moscow, Russia {asa,dan,shpavel,sergeys,cstef,vadim,voevodin,serg}@parallel.ru 1 Introduction ... 2 The Octotron System: Model-based Approach Octotron represents the supercomputer model in the form of a graph (Fig. ...

Еще в разделе: (Показать все результаты (>39) - hpc.msu.ru/ )

... By $A$ we denote the maximum of the moduli (of the absolute values) of the eigenvalues of this matrix . ... Self-similar solution . ... Адаптивный алгоритм . Adaptive algorithm . ... Additive set function . ... Algebraic random equation . ... Proximity analysis . ... Артикли . ... Multiplying the first relation in (1) by $x$ and the second one by $y$, followed by summation, we come to the concise form of the above equations . ... We try to find a solution to equation (1) which is of the form .. ...

Еще в разделе: (Показать все результаты (>42) - num-anal.srcc.msu.ru/ )

• http://num-anal.srcc.msu.su/list_wrk/ps1/ch2st2.ps
• http://num-anal.srcc.msu.su/eng_math/redict/6.htm

... Abstract A Uniform Resource Identifier (URI) is a compact string of characters for identifying an abstract or physical resource. ... This document defines a grammar that is a superset of all valid URI, such that an implementation can parse the common components of a URI reference without knowing the scheme-specific requirements of every possible identifier type. ... URI-reference = [ absoluteURI | ... Otherwise, the reference URI's scheme is inherited from the base URI's scheme component. ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1808.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1945.txt

... Pulsed-field gel electrophoresis (PFGE) typing of 129 vanA-positive E. faecium strains revealed 23 independent restriction profiles with two predominant clonal types. ... Four different Tn1546 types were distinguished according to structural alternations. ... Table 2 Results of pulsed-field gel electrophoresis (PFGE) typing, Tn1546-like element characterisation and multilocus sequence typing (MLST) as well as distribution of virulence genes among 129 vancomycin-resistant Enterococcus faecium...

Еще в разделе: (Показать все результаты (>120) - www.enzyme.chem.msu.ru/ )

• http://www.enzyme.chem.msu.ru/ekbio/article/aminoaromatics-kotova.pdf
• http://www.enzyme.chem.msu.ru/ekbio/article/ADM1-WST.pdf
• http://www.enzyme.chem.msu.ru/ekbio/article/appana_2007.pdf

... The notion of convergence to zero in a vector space allows one to define convergence to any p oint by using a translation. ... The notion of a converging sequence can b e introduced without any top ology, by the definition of all sequences converging to some p oint. ... 1, then the sequence n xn converges to zero. ... In the case of the Euclidean top ology, where for at least one comp onent the inequality ci > 1/4 holds, the set J (f ) coincides with the whole space and hence the Julia set is empty....

Еще в разделе: (Показать все результаты (>36) - shamolin2.imec.msu.ru/ )

• http://shamolin2.imec.msu.ru/art-165-1.pdf
• http://shamolin2.imec.msu.ru/art-168-1.pdf