... We consider now change-points in different components of the frequency spectrum of typical EEG signal. ... Only few change-points in power are found in the initial EEG (unless a prominent alpha rhythm is present). ... Change-points in different frequency components of the EEG . ... Change-points in different types of the EEG alpha activity without substantial gradual changes . ... As can be seen from Fig. 7.3, the program reliably detected the change-points despite of such variety of signal patterns...

Еще в разделе: (Показать все результаты (>71) - brain.bio.msu.ru/ )

• Laboratory for Neurophysiology and Neuro-Computer Interfaces (NNCI) (former
• EEG Database - Schizophrenia
• Change-point synchronization between signals or signal components

... For the investigations of the phenomenon leading to non inflation (squidding) of parachute, the influence of canopy permeability and upstream flow on the character of pressure distribution along framework model, imitating round parachute, was studied experimentally. ... The pressure sensors: 13 ones inside and 13 - outside the canopy have been placed for the study of distribution of internal and external pressure on the surface of the model. ... Variant 1. ... Parachute Science] . ...

Еще в разделе: (Показать все результаты (>8) - margaret.imec.msu.ru/ )

... The nonlinearity has the form of a sigmoid function of two parameters a and b. The zoning of the plane (b; a) with respect to the number and type of stationary states (critical points) for the model under consideration is performed. ... The function g(u) (called a shot function) is expressed by g(u; a; b) = 1 1 + a exp(\Gammabu) (2) where the parameters a and b are positive. ... Analysis of critical points. ... The centerґtype stable critical points correspond to a minimum of the function U (u) [3]....

Еще в разделе: (Показать все результаты (>1487) - num-anal.srcc.msu.ru/ )

• http://num-anal.srcc.msu.su/eng_math/redict/1.htm
• http://num-anal.srcc.msu.su/eng_math/redict/15.htm
• http://num-anal.srcc.msu.su/list_wrk/ps/b1_47.ps

... Randles impedance. Interfacial capacitance. ... Partial currents ik in the bulk solution are determined by transport numbers tk . ... dl Thermodynamics of interfaces ґ binary solution : 2 independent variables, e.g. = +/z+ - -/zsolution: dE+ = ( Cdl )-1 d - t -dl d(/F) d+ = - t+dl d - Cdl d(/F) EDL: + , d- = - t -dl d + Cdl d(/F) metal : THREE independent interfacial parameters: (1) Cdl , interfacial capacitance ( capacitance of the electrical double layer ), (2) t+dl et t-dl , ...

Еще в разделе: (Показать все результаты (>81) - electr003.chem.msu.ru/ )

• Elena V. Stenina: Selected Publications
• Liana N. Sviridova: Selected Publications
• Laboratory of Electrical Double Layer and Electrode Kinetics

... Two-dimension linear regression model. ... The econometric modeling of time series . ... The course aims to provide students with basic models and methods of econometric modeling of financial time series. ... The course considers in detail the major methods of econometric modeling of time series, in particular modeling by stochastic processes, modeling of stationary and non-stationary time series, the spectrum analysis of time series. ... The problem of tax optimization under a given state budget. ...

Еще в разделе: (Показать все результаты (>11) - io.cmc.msu.ru/ )

... Biochemical characterization of small heat shock protein HspB8 (Hsp22)-Bag3 interaction. ... Interaction of human Bag3 with small heat shock proteins HspB6, HspB8 and its K141E mutant was analyzed by different biochemical methods. ... It is supposed that having unordered structure Bag3 might weakly interact with different small heat shock proteins which recognize unfolded proteins and this interaction is especially strong with intrinsically disordered HspB8. ...

Еще в разделе: (Показать все результаты (>71) - biochem.bio.msu.ru/ )

• Structure and properties of chimeric small heat shock proteins containing
• Cardioprotective effect of histidine-containing dipeptides in pharmacological
• Three-dimensional structure of alpha-crystallin domain dimers of human small

... Научные семинары . ... расписание семинаров . семинар 1 . ... Отчет о семинаре || ... This talk will focus on one of the emerging technology for solar light conversion into electricity; the dye-sensitized solar cell. ... The present lecture will give a general background to the solar energy field with a focus on dye-sensitized solar cells. ... С докладом Dye-sensitized Solar Cells Materials and Interfaces выступил профессор Lars Kloo из Королевского технологического института г. Стокгольма. ...

Еще в разделе: (Показать все результаты (>13) - nano.msu.ru/ )

• Dye-sensitized Solar Cells ? Materials and Interfaces | MSU Nanotechnology

... Surface disturbance and deformat ion are shown in the same scale. Displac the free surface is much smoother as compared bottom deformations: init ial elevat ion has amplitude and spreads over a rather wide area. bottom theory, bottom ement of with the smaller F ґ velocity potential, H ґ depth, ґ vector of bottom deformation, 0 ґ initial elevation a . ... The init ial elevation assumed to be equal to the vertical bottom deformat ion (a); calculated with use of the Laplace smoothing algorithm (b). ...

Еще в разделе: (Показать все результаты (>13) - ocean.phys.msu.ru/ )

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>5) - npidb.belozersky.msu.ru/ )

Geometric Structures in Integrable Systems Sergey Adzhiev (with Victor Vedenyapin), Entropy for generalised quantum kinetic and Liouville equations. Abstract: In his 1872 paper L. Boltzmann proved H-theorem for a class of kinetic equations. ... Abstract: P. Clarkson and M. Kruskal (1989) proposed a method for finding reductions of partial differential equations with two independent variables. ... Gennady El, Kinetic equation for a soliton gas ґ a new integrable system? ...

Еще в разделе: (Показать все результаты (>43) - new.math.msu.su/ )

• http://new.math.msu.su/department/probab/spec/Materialy_po_kursam_Tutubalina/Finstat/Bashelie/Bachelier100years.pdf
• http://new.math.msu.su/department/hydro/papers/Osiptsov-Asmolov-PoF-2008.pdf
• http://new.math.msu.su/department/probab/bsk11_13.htm

... In this case both the medium and the electric field depend on two space coordinates only. ... The classical modeling presentation is in apparent resistivity which reflects an electric field distribution on the earth's surface. ... An expression can be derived for the potential value in point M ([pic]): [pic], (4) where [pic] is the potential of the primary electric field, [pic] is the potential of the secondary electric field, defined by the surface charge distribution. ... pic] |[pic] | ...

Еще в разделе: (Показать все результаты (>65) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

... SUPER RATIO . ... On this page I will present the most important (on my opinion) idea on Intellegence Life in the Universe . ... On the problem of the Super Ratio in astrophysics" . ... As a matter of fact, this is the main problem of the modern natural science. ... Here I shall try to speak about the most important problem of the modern natural science, the problem which is undoubtedly, of more importance than discovery of Blacks Holes, creation of Grand Unification Theory or Artificial...

Еще в разделе: (Показать все результаты (>157) - www.pereplet.ru/ )

... Начало www.99ru.ru Книги о РУСИ Славянская традиция 8265 . ... Искусство . История.Философия . ... Художественные . ... История Всемирная . ... Искусство и культура . ... Другие виды искусства . ... Этнография Фольклор . ... Наследие Востока . ... Введите код товара из каталога. автор Велецкая Н.Н. Символы славянского язычества. руб. ... Велецкая Н.Н. Символы славянского язычества. ... Автор этой книги, отечественный славист с мировым именем - Наталья Николаевна Велецкая, делает такую попытку. ...

Еще в разделе: (Показать все результаты (>16) - www.bukivedi.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... In a sphere-plane geometry, routinely used in atomic force microscope and surface force apparatus, it can form a bridge connecting the surfaces. ... By minimizing the free energy of a binary mixture we obtain the force-distance curves as well as the structural phase diagram of the configuration with the bridge. Numerical results predict a discontinuous transition between the states with and without the bridge and linear force-distance curves with hysteresis. ... Phys., Vol. ...

Еще в разделе: (Показать все результаты (>38) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/theses/vardanyan.pdf
• http://nanofluidics.phys.msu.ru/paper/asmolov-vinogradova-2012.pdf
• http://nanofluidics.phys.msu.ru/paper/JCP2013.pdf

Welcome to Fourmilab 's calendar converter! ... In the Julian calendar every fourth year is a leap year in which February has 29, not 28 days, but in the Gregorian, years divisible by 100 are not leap years unless they are also divisible by 400. ... The average length of a year is 365.2468 days compared to the actual solar tropical year (time from equinox to equinox) of 365.24219 days, so the calendar accumulates one day of error with respect to the solar year every 216 years. ... Excel serial day: . ...

Еще в разделе: (Показать все результаты (>7) - sbmg.geol.msu.ru/ )

• Список элементов HTML

... Data . ... Models . Solar energetic particles . ... Neutron flux variations (RU) . ... This software computes omnidirectional, integral, or differential (in energy) fluxes of electrons and protons trapped in Earth's radiation belts for specified energy, L-value, and B/B0 range. The fluxes are obtained by an interpolation procedure from the experimental data. ... MODEL - one of following integer numbers, flux model: . ... AE4MAX, electrons, solar maximum . AE4MIN, electrons, solar minimum . ...

Еще в разделе: (Показать все результаты (>18) - smdc.sinp.msu.ru/ )

• ShielDose2 model - Space monitoring data center
• COSRAD model - Space monitoring data center

NATO Publishing Unit P.O. Box 17 3300 AA Dordrecht A U T H O R 'S D A T A B A S E E N T R Y S H E E T (to be submitted together with the scientific paper ) REFERENCE: ARW978587 TITLE OF THE NATO MEETING/ NATO ASI SERIES VOLUME : Use of Humic Substances to Remediate Polluted Environments: from Theory to Practice NAME OF THE DIRECTOR: Dr. Norbert ... The total space available for keywords and abstract of your paper is 900 characters (approx. 100 words). ...

Еще в разделе: (Показать все результаты (>140) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/publication/2006/2006-blinova-kinetics.pdf
• http://www.mgumus.chem.msu.ru/seminar/mat/Paper-Crystallization-Eng.pdf
• http://www.mgumus.chem.msu.ru/publication/2012/2012-karpiouk-self.pdf

... Выпускники . ... Женский клуб . ... Издательство МГУ . ... The correct theoretical analysis of the generally accepted foundations of theoretical physics is proposed. ... The main result is as follows: the foundations (i.e. classical thermodynamics, the special theory of relativity, quantum mechanics) contain logical errors The existence of logical errors is irrefutable proof of incorrectness of the theoretical foundations and means that theoretical physics enters the greatest crisis. ...

Еще в разделе: (Показать все результаты (>33815) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Американские ученые придумали тест, оценивающий шансы
• Клуб выпускников МГУ: Внутримышечные инъекции - главная надежда на излечение от
• Клуб выпускников МГУ: IN VITRO ВЛИЯНИЕ ОПЕРАТОРА ЦИГУН НА ИЗМЕНЕНИЕ

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>21) - tukachev.flogiston.ru/ )

• Category: Новости